SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|9011|gw1.3425.1.1 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|PhycaF7|9011|gw1.3425.1.1
Domain Number - Region: 96-140
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 0.0785
Family PA2201 N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|9011|gw1.3425.1.1
Sequence length 245
Sequence
MNLRAFLLSAVAALVAVQAEVTYIDHDTVKPFPQPKPTTDSDKAAVKYKPQLLVSYGCHP
YPAVQADGSVSAGLKGTGPXDGECGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGTPGLY
QRRHFWETAVVWIDDPSLANSTILGVSLNYGWRLKTMAPIESEFLDDSRVKLESYRGFSY
PRPKLRFTTHVGETQDLITWEQLTVEAREALSNAEFDSGLIKTIRREMPLKDGVFEKRLK
DAWPF
Download sequence
Identical sequences jgi|PhycaF7|9011|gw1.3425.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]