SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|PhycaF7|115869|estExt_fgenesh1_pg.C_150055 from Phytophthora capsici

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|PhycaF7|115869|estExt_fgenesh1_pg.C_150055
Domain Number 1 Region: 199-397
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-61
Family Sec7 domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 875-1157
Classification Level Classification E-value
Superfamily ARM repeat 0.0000753
Family Exportin HEAT-like repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|PhycaF7|115869|estExt_fgenesh1_pg.C_150055
Sequence length 1316
Sequence
MSCNVAINRIAYPLSTEILYAPVQGDLSKFLLQNSETEELGILSLTLRVVFNLFNSIKDH
LKVQLEVFFTSVHMRIIDSPSCSNEQKELALESLLEFCREPALMLDLYINYDCDVHCTNL
FEVLYLARFTAGGSPGTESSSAEFPMEDISPMSSVRDLMHLVMSGSESDSDSEQSEQDNP
ADQLAWLHTARERTAEVLQQRKRIKKRYALAAEKFNHDQKNWMAFSQQIGLLPEQLTPES
VASFLLHTPGLNKTLIGDYIGDGPVEKYPFNAAVRDAYVAMFDFRSAPSLDEALRMFLAK
FRLPGEAQKIDRMMEAFSKQLYEQAGSSGPLADADAAYVLSFSIIMLNTDLHSDHIAKKM
TVEEFIRNNRGINAGQDLPTEYLTDLYYNILEKEIQMQHDVSDFMESPASTVDRYSMQWD
GVLKRSENVVGASFTSNTSILKLRAGLYEKDMFNLISESTIKSILLAFEKTCDLNNMERS
LEGLSNCAKIMLYYDMRDEFNKIMGSLASYFLTFAHGILSGEKVYVPPSTSSVLKRSSSS
SPLSSSEQGSSEIIGERIVRRQDDGSEIEVLAAPQHVEGSIDEDLVQGAKTRRALLSLKL
LFQFVQNTNEYFRKAWSNVVECMLMFNELDAVPTSLVEIDDFVDSRGVPLPPMQGGVSTH
APSPPKLSPGRGQTGTGLSGKTRERSRRQAERQAAIRSRMKSMTQASQGTAYGSHGQSGN
SGSLWGSLSYYLWAEEEKIDESFSLVNQMLRDEVMKLGGGILEKENWLRLTRKLQEQSLM
SLLETLISCRDPFKCIMQPSDSGVDAMMQENAILVLELSVDIILVNSHRILQLNLWDSFH
LYAKRILSTPLSELHMQGLVERVVVHILRVSIRLFHDEKVRPKLMATLELLLTMDKDMYK
ALSDRLASGITMLLKANLVYMHDFHDWEVLLGILQNVVEYINSRSACWDSVNVLAEGGHL
NDDNITPWMSLCCGFVRHRTSYAVDALKLLQGLANSDNTYKMNGSSWLQVMRVMLKYLND
DRPPVAKTAWDCLRNSLLLPGMPIAKDTWKQCFDDIIFAFDDQVTDVSVRTTRDAPLYSV
TLLSKTFLHNLNVLMELSDFPELWLKVLRRLANKLVVSSSPALRSQQTSVVFETTLQSLY
NLLLVLKAEDVLERVTNEATNETLFDETCAVIDAVCPHLKEQLGLMPDDVAIEMPADGSE
QPTTETEAETERTEETGAVEEDEAIKEGTEETAADEETLERLIPEAEGQVEVTPVDEPMR
SQESADNTVSEPVEDDPLSSSGPPTSTTTLETVIIGDGTFGIKVDEVIVDEIIEAV
Download sequence
Identical sequences jgi|PhycaF7|115869|estExt_fgenesh1_pg.C_150055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]