SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427705564|ref|YP_007047941.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427705564|ref|YP_007047941.1|
Domain Number 1 Region: 580-701
Classification Level Classification E-value
Superfamily OmpA-like 1.83e-30
Family OmpA-like 0.00053
Further Details:      
 
Domain Number 2 Region: 54-207,241-431
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.97e-21
Family Chondroitinase B 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427705564|ref|YP_007047941.1|
Sequence length 728
Comment OmpA/MotB domain-containing protein [Nostoc sp. PCC 7107]
Sequence
MISKNHPYSLKPSQTPLPLCPTLREAAIASMRPLRFVSILLVYLTTLHQIAIAQPSPTSL
QVTVNSNQDGQIQPDDKLTLREAIDLVNGNLSVEKLSNQEKAQVKPSNDNARIEFNLPPN
QTTIQLQQELPALATPKLIIDGTSQPSYDASRSATAEIAIPQPIVAITPAANQEILRGFT
VVADNVQIRGLSIYGFRSLNQGATLTTPPADIFISHRLPPPNTKQQQPPNSNFPFGDKDI
PPKGVVIENNWLGITPDEKMPEKTSAFGVYVFNSTGTKIRRNRISYHEGSAIITSVRAEN
TFMAENIIVGNGIAGMPDAVRLEGVITNSQLQGNLICGNDGAGIYLFKPTGNVKIHDNRI
TFNGRRLRRAAVYLMGNENQVTDNEIRNQTGPGVAVTAFGTHGTFGSAIANIIQNNQFSD
LEGLSIDLNTQQQLNISDFQRGDGPNPKRNSPNRRLETANGAMNAPEFASSQLLLVNGQA
LISGQADPGTQVQIYRVQGNDNYGPLSEPLTTLTADEKGNFSGSLAGLRTGERISAIATH
PKYGTSEPAYNAIIIDPSAKNPSTSPQPTSSPPKCVSAPQPAPQPEPKPEPLRLNVPRII
HFALDKDFISQESSTVLNQIAQVLQQYPFIVIEIEGHTDIRASDAYNLDLGKRRAMSARN
YLLKQGIAAERMTIRTFGEKQRRTSGNTVIDTARDRRVEIIFQDTRGLEIILEEQEKDLQ
IEAIGGDR
Download sequence
Identical sequences K9Q6J7
WP_015111033.1.60169 gi|427705564|ref|YP_007047941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]