SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427705679|ref|YP_007048056.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427705679|ref|YP_007048056.1|
Domain Number - Region: 118-162
Classification Level Classification E-value
Superfamily AF1531-like 0.00693
Family AF1531-like 0.012
Further Details:      
 
Domain Number - Region: 270-370
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0166
Family Single strand DNA-binding domain, SSB 0.038
Further Details:      
 
Domain Number - Region: 11-37
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0576
Family Intein (protein splicing domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427705679|ref|YP_007048056.1|
Sequence length 448
Comment DNA polymerase III subunit alpha [Nostoc sp. PCC 7107]
Sequence
MVKIITRKYIGQANVYDIGVAQDHNFVIENRLIASNCFNKSHSTAYGYVTYQTAYLKANY
PLEYMAALLTANSGDTDKVQKYISTCLSMNIQIEPPDINRSGVDFTPVGGKILFGFSAVR
NVGQNAIACILEAREQQGEFKSLSDFCDRVDLRAVNRRTLESLIYCGAFDKIDLNRHQLI
KDLELVYDWAQSRAKDKASGQGNLFDLLGGFAPTTKTANNVFDSVPKAQSVPDFPPQKKL
QMEKEILGFYVSDHPLKSIKNSSSILAPINLSQLNEQKEDTLLCAVVMLNNVKKVMTKKG
DQMAILQIEDLTAQLEAVVFPKTYERVSNSLEVDARLIIWGKVDRRDEQVQLIVEDAEPV
ETVKLVMVELTPQQAITIEERHKLRNILKELSGDKENAKVPVIGIVQTGNSRQLVRFGRQ
FWVQDSRSTVLALQNARFLAHVKQLTSS
Download sequence
Identical sequences K9Q6Y2
WP_015111148.1.60169 gi|427705679|ref|YP_007048056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]