SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427705731|ref|YP_007048108.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427705731|ref|YP_007048108.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.51e-16
Family 7-Fe ferredoxin 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427705731|ref|YP_007048108.1|
Sequence length 81
Comment Photosystem I iron-sulfur center [Nostoc sp. PCC 7107]
Sequence
MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A0C1R7R8 A0A0M3V5P8 A0A0V7ZXR7 A0A1C0V4M7 A0A1E2WHB9 A0A1U7I7L7 A0A1Z4G7I5 A0A1Z4GIA7 A0A1Z4H4J4 A0A1Z4HSX2 A0A1Z4K0J4 A0A1Z4L030 A0A1Z4MLV2 A0A1Z4MV27 A0A1Z4QCF6 A0A1Z4SHH3 A0A1Z4TYX8 A0A252CSF2 A0A252D3Z3 A0A252DWU6 A0A254WI20 A0A2C6V0I7 B2J393 K9Q6I7 K9QKS0 K9TVB5 K9VT56 P0A412 P0A413 P0A414
WP_012411495.1.21814 WP_012411495.1.22335 WP_012411495.1.26765 WP_012411495.1.33569 WP_012411495.1.41981 WP_012411495.1.44837 WP_012411495.1.4589 WP_012411495.1.5551 WP_012411495.1.56988 WP_012411495.1.57613 WP_012411495.1.60169 WP_012411495.1.62728 WP_012411495.1.72800 WP_012411495.1.75415 WP_012411495.1.7719 gi|428205839|ref|YP_007090192.1| gi|427705731|ref|YP_007048108.1| gi|428303938|ref|YP_007140763.1| 63737.Npun_F5213 gi|427727590|ref|YP_007073827.1| gi|186685290|ref|YP_001868486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]