SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427706019|ref|YP_007048396.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706019|ref|YP_007048396.1|
Domain Number 1 Region: 21-360
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0052
Further Details:      
 
Domain Number 2 Region: 641-745
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 1105-1238
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000239
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number 4 Region: 973-1110
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.061
Further Details:      
 
Domain Number 5 Region: 745-862
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family iota-carrageenase 0.03
Further Details:      
 
Weak hits

Sequence:  gi|427706019|ref|YP_007048396.1|
Domain Number - Region: 1299-1403
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000345
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number - Region: 1231-1296
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00279
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427706019|ref|YP_007048396.1|
Sequence length 1538
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MADRFPFLLVAPLVALGSFFCDAATAQITPDSTLGVESSTIRQETIQGINSDLITGGATR
GANLFHSFSEFNIPAGRGAYFANPPAIQNILTRVTGGNPSNILGTLGVLGNANLFLINPN
GISFGSTARLDIKGSFVAATADSLTFGNNLEFSATNPQAPPLLNVNIPIGLRFRENAGDI
HNAGNLTVGKDLTLQAQNLNLSGIIQAGGNLTLQAQDTVTVRDSVEQPFIAAAGNQLLIQ
GNESVDIFALNHVNSGLFSGGDLVLRSANTVGGDAHYWSGGNFRIEQLDGSLGNLSSPHD
PIIRTTGDVFIGAYEGASLHIIAGGSVTIPGFILITGADPQFGLVENITLSNGQQITIDG
KSQPTLDIRAGVKPEFLGVPSMTESGNDFFLGLNLDSVTPINADINVGAILFSTSLFEGT
KITGNVLLTNQYQPNLSLLGSINVANSLFPLFNEAIQTGSLELSNGGSITIDSRNNIGIN
GIIDAESFLRGGKILIKSGGDILITNATVSATGKEGNINIIGNDITIDNSILNTGVFQIT
GLEDERRTGKIKIIASGTLILNNESSIVDGIISASIVENSDTQVNSQIGNNIDIETRYLE
LNNSIISTLSLGIGSAGNIKIKATEAIKLESSSLFERSFISSRVSGLGSVGNAGSIVVET
NMLELNNGSAIESTQDGRGNAGNINITATESIKSNGLLDENFITVGITSGLGQNGIGKSG
DIQIVTKNLELVDNSQISAITFGRGDGGNINISADNIRLDNFSFITNSPSDISSQIGGIT
QIGNTGNIEIYAKSIEVINLSQIASNTLGVGDAGDIKITAEHNIMLEGGSFINSEVSTAL
LTEVIGNAGNIWITTPKLSVQNISGIFSQAQDTEGNAGNIEITTGELTLKGASRISSLTN
SNQSKPGSIIINNGRNPTQFISLEESRITAEIGNNATLNPEITSNIEEININSNIINLFQ
GSTIRTLTAGGINASNVNISSASINLNQSSRIETLTNSNSSAGNIIINSKESVNIANSNS
GLFAQTENTGNAGNITINTPIFNILNNAEVSAFTTGIGNAGSITINAPQRVDIGQGSRIV
VETSGAGNPGDINITTNTLNIGEDAELSATARATATNRQGGNINLNTSNLNISGRLGIFA
ETQGISPAGNLTLNPNSINPILNINFTDNGFISASTTAVGNGGNINISAPEVIDIQGEGR
IIVETSGSGNAGRIDITAQTLNLANGVEISASTNGTGNAGDILLTIQDNLNLTNSAIASS
TTPNSTGNGGNIIIDPDQVNLNNRAQISVNSQGQGDAGSIFLTANNLTLNNSSTISAATA
SGEGGNINLNIANLLRLRNNSPITATANGTGNGGNININTTFLVANQDSDITANAFAGRG
GNINITTQALFFSPDSQITASSELGVEGVVAINTPEIDPSQGLLNLPETVVDPRTLINQN
ACQRGRQSEFTITGRGGLPSSPEQFPNSDEVEVGLVTPSEESVTRVTSPLPTAVTSEKIV
PAQGWVRNEKGRIILVGYDPSNANIQRQKTNLTACQPR
Download sequence
Identical sequences K9Q7W7
gi|427706019|ref|YP_007048396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]