SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427706040|ref|YP_007048417.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427706040|ref|YP_007048417.1|
Domain Number - Region: 63-179
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00129
Family Apolipoprotein A-I 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427706040|ref|YP_007048417.1|
Sequence length 189
Comment hypothetical protein Nos7107_0594 [Nostoc sp. PCC 7107]
Sequence
MQQELNRLEDLILSSWRVPLTGRTLIDEEKLFEQLDFIRVSLPSVFQEASAIMQHKQEVM
LEAEEYGQQIVEAAQAKRAQILAESDILRQAEREAEQLRRTTQQECEEMMQETIAEIDRR
RQACMEELEQMRQTAIAQAQEIEDGADQYADTVLENIEQDLKDMLRIITNGRQQLRQENQ
SQGYSSKKK
Download sequence
Identical sequences K9Q8Y5
gi|427706040|ref|YP_007048417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]