SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427706292|ref|YP_007048669.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706292|ref|YP_007048669.1|
Domain Number 1 Region: 41-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.96e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 438-557
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000248
Family P22 tailspike protein 0.069
Further Details:      
 
Weak hits

Sequence:  gi|427706292|ref|YP_007048669.1|
Domain Number - Region: 569-676
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.034
Further Details:      
 
Domain Number - Region: 359-424
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00148
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427706292|ref|YP_007048669.1|
Sequence length 890
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MSHICWRLHLGAVLAVGGAFVTTSIESSLAQSITVDGTLGSTQTINGPNYTIPQSVGQTV
GSNLFHSFGRFSLNTSESAVFQSAGEIRNILSRVTGGLPSRIDGLIRTDSNNVNLFLINP
SGIVFGPNARLDVGGSTRGSFIATTADAIVWGNNSQFSATNPGGVNSLLTIVGDPSGFLF
NRPPQAIAVNGSELSVDQSQSLLLLGGKINLNNSLLEVDSSVGGQIELGSVGAPGKVGIT
TQGNILNLDFPRNLVRADVSLRNNAQVNVFAEVGGSINVNTHNLNLEGGSHIQVAIPEGS
GDINSRTGDINVNATGNIHLQQRSMISTAVAINATGNAGNINIVTNSLLAADGSQVNASS
FGIGDGGSISITAGDAVAFDGVASDGLISSAISYIDAGAEGNGGIVTINARSLTLTNGGQ
VSASVRSATNTLPGGQGNAGNVNVNVRDAIIINDANSGVLSLLGVGAVGRGGNIEINTGS
LTVTNGGQVNASSFGIGDGGNISITAGDTVAFDGVASNGLISSAISYIDAGAEGNGGIVT
INARSLTLTNGGQVSASVRSATDSLPGGRGNAGNVNINVSDTTTITGRSANATNSGILSL
VGVGAVGNGGNVNLDTENLTLRDNAELTVSNRGIGNAGNIRANAGNIVLDNQGQITATSL
SGQGGNISLQVRDILLLRRNSFISHISGTPEAGGTGGNFLANAGFIVAVPSENSDIITNA
FNGSGGNIIINAQNIFGLQFQPQLTLGSDIVATGTVTLNTPNIDPVQSLAYLPTTVDAPE
PIGQSCRNNQTGSQFNVTGRGGLPGSPDESLSGDVVWSDTRLTVAAKPQHNPTIPGTQKQ
SNIADHLAIVPATGWVRDRQGKVTLVAHSPNISNSNVGYLGTHCQIPQPD
Download sequence
Identical sequences K9Q8T0
WP_015111758.1.60169 gi|427706292|ref|YP_007048669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]