SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427706780|ref|YP_007049157.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706780|ref|YP_007049157.1|
Domain Number 1 Region: 23-169,197-351
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0086
Further Details:      
 
Domain Number 2 Region: 509-614
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000141
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 3 Region: 370-538
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000239
Family iota-carrageenase 0.093
Further Details:      
 
Domain Number 4 Region: 612-660,694-720
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000314
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|427706780|ref|YP_007049157.1|
Domain Number - Region: 695-832
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0785
Family iota-carrageenase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427706780|ref|YP_007049157.1|
Sequence length 957
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MKNYIFTSCIISATIWCSLPFMDLSQAQIVPDTTLPKNSAVAPLDNMNKWKITEGTLAGN
NLFHSFQQFIIPEMHTADFVNPSANIQNILVRVTGGSRSDIFGTLKTSGIGSPNLFLLNP
HGILFGPNASLNVGGSFVATTANAIAFGNQGSFSASVPNNPALLTVNPSAFLFNQIVSSS
IINQSTYQNPYTQSVVGLSVPNGKSLLLLGGNVSLDGGNLSAPGGRIELGAVKGEGSVEL
NANNQNLHLSYPQNLARGDISIINGSANVVSNGGGSLTINARNLEITRSNLTNGIIGDGT
QAGDITLNATERINIRQSTISNNLGEIFLLANGNTGGVYIKAKSFFLSDSFIRSDIGAFL
SSARGNTNGVHIQAESLSLNNSNISSDVNDGSMGNTGGIQIVADSVYINSDISSSPTGLS
AITLGSGTTNGVFIEVNNSLVLKNSFINTRSNNNSTGNAGNINIQARDIFLTDASSLDTS
SSSTGSAGNIVINTQGLFLDNRSSIRSETNGIANPGLIDITARTLTLANGAAILSRTTGS
KNGGNIQINASESIKLIGFSPDSQSGLLISGFFTSTENERNLTASGNAGNIDIKTRSLQV
RDGAVISARSRSVGDGGNINIIANTVDLAGGGQIVTSAFNNGNAGNITLEAKNGVRITSS
EPTFAARVEQFGSESIDNDGANSGLFARVRGTERANAGNITVNARSLQLNNQGTITTGTT
AGEGGNINLNIRDIVLLRNNSSISANAGTANAGGNGGNISINTKFLIAIPGENSDISANA
FNGRGGRVDITAQSIFGIASRFRDTNFSDITASSQLGINGEVTITTPQVDPIQGLSELPT
TVVDSSTLLAADCSKDEENDNSQFIVTGRGGLPDNPYEVLGSDILWSDTRGREIVAMKNQ
PVMTKSPSVNKTVAIVPANGWVFNGAGEVTLISDVSGAADNPVKSNAYACPKATAMK
Download sequence
Identical sequences K9QB13
gi|427706780|ref|YP_007049157.1| WP_015112233.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]