SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427706886|ref|YP_007049263.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427706886|ref|YP_007049263.1|
Domain Number 1 Region: 555-656
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-30
Family Extended AAA-ATPase domain 0.00034
Further Details:      
 
Domain Number 2 Region: 130-246,495-559
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.88e-29
Family Intein (protein splicing domain) 0.061
Further Details:      
 
Domain Number 3 Region: 6-133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.23e-23
Family Extended AAA-ATPase domain 0.0000928
Further Details:      
 
Domain Number 4 Region: 675-795
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.62e-20
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427706886|ref|YP_007049263.1|
Sequence length 1060
Comment AAA ATPase [Nostoc sp. PCC 7107]
Sequence
MPYEPLHHKYRPKSFAELVGQEAIATTLINAIRTAKIAPAYLFTGPRGTGKTSSARILAK
SLNCLKSDTPTAEPCGVCDVCQGITKGYSLDVIEIDAASNTGVDNIRELIEKSQFAPVQC
RYKVYVIDECLTGDSLVLTDEGLIRIDNPKLKGKRVLSYNDSSGQWEFKKVLRWLDQGER
PTLVIKTTKGLIKCTENHLIRTAQGWIPAKNVKEGAKILSPVNVAAATSFTNMVRMDASG
DLLADTSLKATNTGKDPTTWNLFFKQQNCSDLCVLADAEKNSMSLPIYSKKVKALPAYNL
IGEEIRIKKDTGFGNLEQKDFWKKPLFYNQRYSDLSTALCWGIVPSLTPTNTVDSLDCVG
HMVKARENGWNTKHIAFNNCVPSWELQITKDMETYQLPVTPCVIPNSKMSLRSSNRMGIE
KLCQWTGSIELLQKDLLGGIAMMAHSALHQQVALKFSYIQKDSLLKKTNLLPVGLQIWDT
QQKQSVTSEIVQVSNTTIFGWAQIVVENGWQNSNNIPSQQWITSLETVESVHLDGIERVY
DIEVADNHNFVANGLLVHNCHMLSTQAFNALLKTLEEPPKHVVFVLATTDPQRVLPTIIS
RCQRFDFRRIQLEAMVKHLNAIAWKESIDISEAAVTLVAQISQGGLRDAESLLDQLALLS
GQVTPDRVWDLVGSVSERDLLALLGAIAQDNPEAILDCSRYILDRGREPLTILQNLANLY
RDLLIAKTAPNRQDLVVCTGQTWSALIELAQNLHISTILAGQQHLRTAEVQIKNTTQPRL
WLEVTLLGLLPSASIQPAATVVLPKVSIPAPQNNHHPSPPATQPAAPAPLQQQAISPPPP
PITSPAPTQPVTPVTVAAELDLTAIWQQVLSNIQQIPRRALLGQMCHLIEFDGNSARVGV
KPAWYDKVKSDLTMIAGAFQQTVNRNVEVSLEKATAATSSTAKKEPSNNVSNGVQQPAPA
KNNNHHQAPAPQSFTPPPIQVQQSPVKTEFSANGNGTVNIQPVPPQPTQNSSEEWEEVTR
AAQHLAQFFDGQIVRFADDGSEFSGSMTPSDWVDEAEVDD
Download sequence
Identical sequences K9Q9Q5
gi|427706886|ref|YP_007049263.1| WP_015112339.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]