SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427707139|ref|YP_007049516.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707139|ref|YP_007049516.1|
Domain Number 1 Region: 589-724,753-915
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-35
Family DNase I-like 0.07
Further Details:      
 
Domain Number 2 Region: 1170-1314
Classification Level Classification E-value
Superfamily beta-Roll 2.22e-25
Family Serralysin-like metalloprotease, C-terminal domain 0.0007
Further Details:      
 
Domain Number 3 Region: 210-332
Classification Level Classification E-value
Superfamily CalX-like 1.2e-20
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1079-1179
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000157
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 5 Region: 925-1001
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000557
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707139|ref|YP_007049516.1|
Sequence length 1321
Comment endonuclease/exonuclease/phosphatase [Nostoc sp. PCC 7107]
Sequence
MSIEFNGSYSENFDSLASSGSSGVLPSGWALLETGTSANVNGQYTAGTGSNNAADIYSFG
ATGSSERAFGTLRSGTLNPSIGASFTNTTGSTITTLNLSYRGEQWRLGAANRGSDRLDFQ
YSLNATSLNTGTWVDVDNLDFNSPVTTGTVGALDGNTNSSQITTTITGLNIPNGATFWFR
WLDFDVTNADDGLAIDNFSLSTGVTPPAVPLVAIAATDATAAEAGTEPGTFRITRTGDTS
NVLTVNYTVAGGANQTDYTPNLTSSVIIPAGQSFVDITITPVDDSLVEGNETVTLTLVDT
ADYDLSAIATATVTITDNDVAPGAVRIHDIQGTAHISALNGQGVVNVAGIVTAIASNGFY
IQDPTPDNNDATSEGIFVFTGTTSAILSARAVGEALLVTGTVSEFRPANNSNNLTITQIG
SNNSVQSLSVSAWTDAPTTTITPTILGNGGRTIPTQVINDDFATSGNVETGGDFDPVNEG
IDFYESVEGMLVQINNAIATSPTGNFGTSEEIWVLPDNGANATSRTERGGSLITATDYNP
ERIQIDDLINGSVTLPGVNVGAQLSTITGVVNYDFNNYEVLVSSAPTVVQPSTLQREVTT
LIGNADQLTVATFNVENLDPGDGATQFANLANRIVNNLRSPDILSLEEIQDNNGATNNGV
VDASGTYQTLINAIAAAGGPRYEYRQIDPVNGTNGGEPGGNIRVGYLFNPQRVTFVDRPG
GTSTTSISVTNVDGTPTLSTSPGLIDPTNPAFSSSRKPLVGEFVFNGQTVYLIGNHFNSK
GGDQPLFGPSQPPGLSSEAQRQQQAIIVRNFVQEILAINPNANIAVLGDLNDFEFSNPIN
TLESAGLTSLIETLPANERYTYNFQGNAQVLDHILASQNLVNNLDGYDVVHINSEFFDQD
SDHDPVIARFNLPPANQAPTTVTFNNAVTSINENSNTTNRIKVADISITDDGRGTNNLSL
TGADASLFEIDNSVLYLRANTNLDFETQSNYSVTVAVDDPTVGNTPDAVANFNLAVTNVN
EAPIARNDSATTTDIQPVIINVLANDSDPDSNALTINSFTNPTRGNLVRNNDNTFTYTPE
IGFTGADSFTYIVSDGNLSTTATVNLTVTLGSNQINGTNGNNILLGTSRIDVIRGLGGND
IISGLGNNDVLYGGDGNDILDGGAGNDSLYGENGSDILYAGDGNDTLNGGAGNDMLLGDA
GNDILIGGLGKDILAGGNGRDSFYLNRGAVNSDIITDFVSGLDSLVVSQSEFGLNQALGT
LDPGLFRLGSSATVASDRFIYDRNTGKLFFDQDGIGSVAKVQIAQLSNRPTLSNTDFTVI
A
Download sequence
Identical sequences K9QB68
gi|427707139|ref|YP_007049516.1| WP_015112587.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]