SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427707556|ref|YP_007049933.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707556|ref|YP_007049933.1|
Domain Number 1 Region: 43-154
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000127
Family Homeodomain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707556|ref|YP_007049933.1|
Sequence length 199
Comment hypothetical protein Nos7107_2165 [Nostoc sp. PCC 7107]
Sequence
MSNYSSQYQGLENYDPQDSKFLTPFQRKALLKNLQSNLQPEYLRRIEIMLLADMGKSQTQ
ICEIVGCSQEMARYWIGIAEAGFAHKWNERPIGRPKIVNAQYIDRLKELVSHSPRDYGYA
FTHWTAQWLSKHLANELGISISDRHVNRLLKQMGLSTKPKSSKQEATEETKDNNITIGDL
KTHSEPTFPWSFNLMQTNQ
Download sequence
Identical sequences K9QBP3
gi|427707556|ref|YP_007049933.1| WP_015112998.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]