SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427708221|ref|YP_007050598.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708221|ref|YP_007050598.1|
Domain Number 1 Region: 17-150
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.29e-45
Family Molybdopterin synthase subunit MoaE 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427708221|ref|YP_007050598.1|
Sequence length 161
Comment molybdopterin synthase subunit MoaE [Nostoc sp. PCC 7107]
Sequence
MTNTFTAPVKPRIEDSFAITFAPLSLEEIYAKADASANGAVVVMSGMVRNNTDGQPVVAL
EYQAYEPMAMQVFYQIAAEIRTFWTEINRVVIHHRIGRLQVGEISVLIAIGCPHRGEAFE
ACRYAIDTLKHNAPIWKKEHWQNGSSTWVSIGACEQSGENC
Download sequence
Identical sequences K9QDL9
WP_015113659.1.60169 gi|427708221|ref|YP_007050598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]