SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427708469|ref|YP_007050846.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708469|ref|YP_007050846.1|
Domain Number 1 Region: 128-228,473-511
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.67e-22
Family Intein (protein splicing domain) 0.025
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily dUTPase-like 1.44e-18
Family dUTPase-like 0.01
Further Details:      
 
Domain Number 3 Region: 510-575
Classification Level Classification E-value
Superfamily dUTPase-like 0.00000000000733
Family dUTPase-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427708469|ref|YP_007050846.1|
Sequence length 582
Comment Hedgehog/intein hint domain-containing protein [Nostoc sp. PCC 7107]
Sequence
MIKNDKWITEMAQQGMISPFEPSLIRKVQKETSVDAQPVISYGLSSYGYDIRLSPAEFRI
FRHIPGTVVDPKNFNPHNLESTPLHTDVNGSYFILPAHSYGLGVALEKLEVPDNITVVCI
GKSTYARCFRGDTRVALVDGTSPTLEEMAERSENGEKFWGYSIGQHGRIIVTLLENPKYI
GRDSLLEVTLDNNESIFCTPDHLFMTRDGRMVEAHTLKPQDSLMPLYRQVARGYEMVYQP
LNGHLYPTHRLSDEWNLYYGIYDNTPNTHRHHVDFNRLNNNPWNIVRMDASAHIRLHNQE
NYGDEFDPDEHGESIREAFARLKQNADWNAMFSQQQKEKVVNFWHDPKYEEIRQRVIEGR
RNCSDDTRQAHRDAMIEYYKNPTARALTGELSKQAWAKDDGTRRYQQSQLMKQLADASKT
RHEITADVVRSALDQTGSIRGAARLLNCDRSVFRRFPDVIQSFRGLSQTHSLKNHKVLSV
KEVPGIHDVYCLTVPEAGNFALEAGVFVHNCGIIANLTPAEAAWRGHLTLEFSNSSSADC
RIYANEGVVQLLFLEGEPCAISYDTRQGKYQDQLEIVTIARV
Download sequence
Identical sequences K9QET0
gi|427708469|ref|YP_007050846.1| WP_015113905.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]