SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427708607|ref|YP_007050984.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708607|ref|YP_007050984.1|
Domain Number 1 Region: 2-322
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.4e-45
Family Pectate transeliminase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427708607|ref|YP_007050984.1|
Sequence length 546
Comment parallel beta-helix repeat-containing protein [Nostoc sp. PCC 7107]
Sequence
MPQTFYVNPLTGNSSNSGSQQAPFKTITQALKVATPDTTIQLTDGNYSVASGEVFPLTIP
SGVQVIGNEANKGSSILIEGSGNYLSRTFAGQNVTFVMLDGGELRGVTVTNPASRGSGVW
AESTTPTIANCTFKNCKREGVFATGDAKPVIQGNVFTENAANGIAIAKNSQGQIQDNTCI
KTGFGIAISDTASPTLLNNKFTENRSGIVVSGNARPVLRNNVSENNTDDGLTVISTALPD
LGSAASPGGNIFRNNAKFDLQNASSNQLISIGNQIDPSKVSGNIQFASAPVPTPTPIPTP
TPTPTPVPTPTPTPVPVPIPTPTPTPTPVPTPTPTPTPVPVPIPTPTPTPSPIDLTDIAN
HWAAAFIRELVKQGIVNGFPDRTFKPDATMTRAQYAALIVKAFTPSSKRAAAQFKDVSAS
FWAAKVIQQAYQGQFLSGFPDNTFRPNQNIQRVQVLVSLVNGLELGTSGNVANANKIFDD
QAKIPDYAKDEVAKAIDKGIIVNHPNLKQLNPTRDATRAEVAVMVYQALVDAGRVAAINS
QYIVNG
Download sequence
Identical sequences K9QFK8
WP_015114041.1.60169 gi|427708607|ref|YP_007050984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]