SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709686|ref|YP_007052063.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709686|ref|YP_007052063.1|
Domain Number 1 Region: 46-373
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.19e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.018
Further Details:      
 
Domain Number 2 Region: 490-607
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000132
Family iota-carrageenase 0.06
Further Details:      
 
Domain Number 3 Region: 694-814
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000289
Family iota-carrageenase 0.067
Further Details:      
 
Domain Number 4 Region: 601-693
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000107
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 5 Region: 811-859,890-913
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000126
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 6 Region: 382-483
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427709686|ref|YP_007052063.1|
Sequence length 1152
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MREKTIKITQSYYLSKLKLILALSSAIITTSANNVLAQNITIDGTLSPAQTLNGPIYIIP
QLVGQTVGSNLFHSFGSFSLDSREIANFQSGSDIRNIFSRVTGGSPSFINGLIFTQSASV
NLFFVNPSGIIFGPNARLDVGGSTRGSFVATTADALVWSNGSQFSATNPGGTSSLLTIVG
DPSGFLSVQRPQSIFAIGSTLNVYQGQSLLLLGGDIGLFNSRLLVNGIEGGRIELGATAA
ESGTIELTTKNNILSLDFPQDSLRADVLLTNGSSLDVSAGNGGSIAINAKNIDILEQSNL
AAGIAPGLGDVNSQAGDVTLNATGVIRVSDQSMIINYTDLFATGNAGNINIITDNLHLTN
NAVITNRTFGQGNAGNLIIKANQSISLDNTSVIGNTVDVRAAGNGGDISITTSSLSLSNN
SGVITFSSGRGNAGNLMINVNENISLDNARIASGIEAGAVGQGGDISISTGSLSLNNNAG
IGAFFEDGNGNAGNITINARKDIFLDSQSSIESTTILAGNSGDVRISTGSLLLTNTASIS
AATFGTGNAGNVIIDARESIFLDSQSRIASSVQELARGQGGDIKITTNSLSLSNSAALFT
TTLGQGNSGKINIATNSLDITNNAIISSITLGQGNAGNIIINAREGISLDGGFILSAVNT
ESVGQGGDIGIITESLSLTNNAILSSSTLGQGNAGNLMINAHGFVLFDRSNISSSALDTA
VGDGGDISITTGSFSISNGTQLFASTLGRGDAGNIYISASEAVNISGTDANKRFSSGLFT
STSTGKGGDIVVNTNLFRLSDSAVLDARTVNEGNGGNITVNANSLEVLNGGQLITTTLGR
GNAGKITVNATEKVIVNGNDASFNDRVAQFSGNVANVDAASGLFVRSDGLGSAGDIEVNS
PFVLLDNGGRFIAESRSVNGGDISVNAGNALLLRRGSQISTTAGTAQAGGNGGNININAG
FVIALPNENSNITANAFSGTGGQVQINTQGIFGIEPRLNDSINSSDITASSTTGINGEII
INTPNVDPTQGLTNLPGDIVNTASLVDSGCTAFGDKTGSQFTVTGRGGLPTSPDDVLNGD
AVWSDTRLTVAAKPQNGSTSRVNTPQKSSNAIAIVPATGWVFNNKGEVTLVSQVAKANAF
NFDSNHVACVKP
Download sequence
Identical sequences K9QHR7
WP_015115110.1.60169 gi|427709686|ref|YP_007052063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]