SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709692|ref|YP_007052069.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709692|ref|YP_007052069.1|
Domain Number 1 Region: 6-378
Classification Level Classification E-value
Superfamily Citrate synthase 1.96e-139
Family Citrate synthase 0.0000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427709692|ref|YP_007052069.1|
Sequence length 378
Comment citrate synthase [Nostoc sp. PCC 7107]
Sequence
MMVCEYKPGLEGIPAAQSSISYVDGQKGILEYRGIRIEELAEKSTFLETAYLLIWGELPS
KEELQAFEEEVRLHRRIKYRIRDMMKCFPESGHPMDALQASAAALGLFYSLRDLHNPAYI
RDSVVRLIATIPTMVAAFQLMRKGNDPVKPRDDLDYSANFLYMLNEKEPDALAAKIFDIC
LILHVEHTMNASTFSARVTASTLTDPYAVVASAVGTLGGPLHGGANEEVIQMLEEIGSVE
NVRSYVEERLQNKQKLMGFGHRVYKVKDPRAIILQDLAEQLFDKFGGDKYYEIAQEMERV
VEEKLGHKGIYPNVDFYSGLVYRKMGIPTDLFTPIFAIARVAGWLAHWKEQLAENRIFRP
TQVYNGKHEAPYIPLEER
Download sequence
Identical sequences K9QIM2
WP_015115115.1.60169 gi|427709692|ref|YP_007052069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]