SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709729|ref|YP_007052106.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709729|ref|YP_007052106.1|
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.5e-53
Family Hypothetical protein TT1808 (TTHA1514) 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427709729|ref|YP_007052106.1|
Sequence length 197
Comment hypothetical protein Nos7107_4422 [Nostoc sp. PCC 7107]
Sequence
METLTLNIPPAVGLTDEQFYQLCIANDEWCIELTAEGELIIMPPTGGESGIQNSELTTEL
TLWNRQAKLGKVFDSSTEFRLPNGAYRSPDAAWVKQERWDALTPDQRRRFPLICPDFVIE
LRSQTDSLKKLRAKMQEYRDNGASLGWLIDPITPLVEIYRPGVEVEMINFTFEQPPTLSG
EDVLPGFILSLTTILNP
Download sequence
Identical sequences K9QIH7
WP_015115152.1.60169 gi|427709729|ref|YP_007052106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]