SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709753|ref|YP_007052130.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709753|ref|YP_007052130.1|
Domain Number 1 Region: 38-110,138-187
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000562
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709753|ref|YP_007052130.1|
Sequence length 192
Comment Cell wall assembly/cell proliferation coordinating protein, KNR4 [Nostoc sp. PCC 7107]
Sequence
MSNLNWFSFLKKESKKAIENYENGEVYWIMVDFSPEAIESQWLGFSGVAEEKIIAVEAHL
GTKLPFSYREFLKVTNGWPEYPGFLGLRKIEEIDWFYVENQDWINIWMEPGGLPPISDEQ
YLRYAKGLEQEIRLEYLQTALQISDALDGEVILLNPQVTHNNEWEAWLFSDHIPGAKRYR
SFWEMLTIRGIS
Download sequence
Identical sequences K9QH66
WP_015115174.1.60169 gi|427709753|ref|YP_007052130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]