SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710029|ref|YP_007052406.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710029|ref|YP_007052406.1|
Domain Number 1 Region: 20-150,184-363
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.0094
Further Details:      
 
Domain Number 2 Region: 384-512,542-572
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000115
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|427710029|ref|YP_007052406.1|
Domain Number - Region: 572-667
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0973
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427710029|ref|YP_007052406.1|
Sequence length 819
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MKLTFVGFGVLSVIWLSVVYNNSVHAQVTPDNTLNTSVTSTTSMSGSNSYTINNGTRVGN
NLFHSFSQFSVPSGGSASFDNATDIQNIFSRVTGGNISNIDGDISAKGSANLFLLNPAGV
IFGQNARLNIGGSFIATTANSIKFADGTEFSTLQGVDKPLLTMSAPVGLQMGSNSAAIKA
QGRGYTNSGSVIVPTPNSTELQVKPGKTLALVGGNLQIDGFILTAPEGRVELGSTNGTGQ
VDLIPNAQGYALGYENGQIFGDIQLAEKSLINVSGVNSGSVRLQAKNISLTDGSLILAQN
YGYLPGGEISLQASTGIDLIGTSNDGNVLSGVRSETYGIGAGGNIGIFTRKFNLQEGSGL
NNLTLGIAPSGNIEIDAKIIEISGFSQINPNRVTGISTLSFASGSAGDVFVSGDNLLISG
GASLSSVTFGSGSSGKVSIRNQNTTVIGNSPSGFDSAITLATFAFGDNKDLILDTGKLQI
LDGGRIGSSTLFAGNGGNVIINASEAIAISSRNNNNNSAINSSATRLNAQLRQSFGFPDM
LTANAGSLSIKTPNLILTDGATVTVTSEGTGNAGNLNIVADIIQLKNQALIQAQTESGNG
GNIDLKVGSLLLMRDRSKITTTAGSTGNGGNITINSPTIVGLENSDITANAVGGKGGNIN
ITTQGIIGLEYRSELTPENDITASSEFGVNGTVEINNIGVDPNSGLVELSGNFTDSSQKI
ASGCNANTGSSFVATGRGGIPQNPTQDIKSDRTWSDIRDISAFHTTKPAQAQIPKSPETL
VQATSWRRNAQGKIELVAAQSPTSMQPSLTCAAIPKSSI
Download sequence
Identical sequences K9QJC5
gi|427710029|ref|YP_007052406.1| WP_015115447.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]