SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710030|ref|YP_007052407.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710030|ref|YP_007052407.1|
Domain Number 1 Region: 24-371
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.53e-45
Family Filamentous hemagglutinin FhaB, secretion domain 0.0091
Further Details:      
 
Domain Number 2 Region: 345-497
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000534
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 3 Region: 465-574
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000213
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number 4 Region: 544-669
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000213
Family Filamentous hemagglutinin FhaB, secretion domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427710030|ref|YP_007052407.1|
Sequence length 823
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MKLTFTGLGFIGAIFVSAIYNSSVHAQVIPDHTLNTSVLQNGNNFTITDGNRVGNNLFHS
FSQFSVPSNGSASFNNAVDIQNIFSRVTGGSVSNIDGLIQANGSANLFLLNPSGIIFGQN
ASLNIGGSFVGTTANSIKFADGTEFSAVNATTNPLLTMSVPVGLQMGTNSGNIQLQGKGH
QLTGGTFTPVIRDNTQSTLEVNSGQAIALIGQNVTLSGGVLTAENGRIELGAVKAGTVNI
NDSSSEFQLDYANIESFGDIQLVNQSLVDASGLTSRGIQLQGNNISLKDGSAALIQTVGS
QAPNSIRVRATGSLDLAGDVRTAPDVGIVTGVISSRLMTETLGKGKGADINVSAGDLLLN
DGGILLARTYGFDSGGNINVNIARDIQINRVTPLNPIATSGIATPTFGSGQSGNINITAS
NLTITDGGLILSNNFGKGDSGNVNVNISRTIEIKGIYPITLAPANISSTVFGKGNGGSVN
LKTSRLIVENNASVSTASLNSGAGGNLTINASESIELRNGGISAAAPILPTILRQAFGLP
DRPSGNAGSVTINTPTLQIDNGGVVAVNNEGLGNGGILNINGNSLRLDNKGRLIANTASG
EGGNINLNLKSDLILRNNSFISTEAKGTGNGGNLTINAPIILGLENSDIIANAVQGNGGN
IDITTQGIIGLKFRDTLTPREDLTNDITASSQFNLNGTVEINNIGIDPNSGLVELPANIT
DPSQQIASGCSNNTGSSFVATGRGGIPQNPTQDLKSDRTWSDIRDIAAFQTTQPVQAQIP
KSPETLVQATSWRRNTQGKIELVAAKSPPQMPPVLTCAAVVKN
Download sequence
Identical sequences K9QKB5
WP_015115448.1.60169 gi|427710030|ref|YP_007052407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]