SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710032|ref|YP_007052409.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710032|ref|YP_007052409.1|
Domain Number 1 Region: 24-361
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.39e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.0066
Further Details:      
 
Domain Number 2 Region: 332-435
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000753
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|427710032|ref|YP_007052409.1|
Domain Number - Region: 470-589,626-639
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000166
Family Filamentous hemagglutinin FhaB, secretion domain 0.04
Further Details:      
 
Domain Number - Region: 629-728
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 0.0549
Family HlyD-like secretion proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427710032|ref|YP_007052409.1|
Sequence length 821
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MKLTFTGLGFIGAIFVSAIYNSSVHAQVIPDHTLNTSVLQNGNNFTITDGNRVGNNLFHS
FSQFSVPSNGSASFNNSTDIQNIFSRVTGGSVSNIDGNISAKGSANLFLLNPAGIIFRQN
ASLNIGGSFIATTANSIKFADGIEFSATNITSPALLTMSVPVGLQLGSNPGAITVQGAGH
NGSFSASSSISGLNVGTRGLQLQSGKTLALVGGNIALDGGLLSAPGGQIELGSVSNVSVS
LNSTSQGFTLSYPSTANFGNITLTQRALASTRDLSRGNGGSVNIQGKQVSIRDGSLVLVQ
NRSNQAAGDIVINATESLDVIGKSPDFTSSSSLINDTMSSEAAGNVIITTPKLNVDQGGY
ILNRTFSAAAGGNIVVNSDAININGFALGDPTPFRAVSQILAASFGRGQGGNISLSTQDL
SISAGANIAARPYSSGKGGDVNVKADTIQVIGTGTPKGSYFSLLSAATFGPGDAGNLNID
TRKLSVQGGGRVSASSIILGNAGSLTINASESIDVSGMKPEETPSYIGTAALPVGSFSTI
SRANAGNTNINAPLVTVSDGATIFVQNTGLGTAGNLQINANTLTLKNGGNLLASTKAGEG
GNINLQLRDLLLMRYGGFISAEAAGSGNGGNISINAPVIVGLENSDIIANAVQGKGGNIS
ITTQGIIGLKFRDTLTPRVDLTNDITASSAFNVNGTVEINNIGVDPNSGLVELPANVSDP
SQKIASGCSANLSSSFVATGRGGIPQNPTQDLRSDRTWSDIRDISAFQETQPVKAQTPKS
PETLVQATSWHRNPQGKIELIADKSPSQMQPSLTCAAVPKN
Download sequence
Identical sequences K9QJJ2
gi|427710032|ref|YP_007052409.1| WP_015115450.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]