SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710033|ref|YP_007052410.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710033|ref|YP_007052410.1|
Domain Number 1 Region: 39-338
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.47e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.0085
Further Details:      
 
Domain Number 2 Region: 453-586
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 348-451
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000261
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Weak hits

Sequence:  gi|427710033|ref|YP_007052410.1|
Domain Number - Region: 586-682
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0345
Family Filamentous hemagglutinin FhaB, secretion domain 0.05
Further Details:      
 
Domain Number - Region: 644-742
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 0.0798
Family HlyD-like secretion proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427710033|ref|YP_007052410.1|
Sequence length 836
Comment filamentous hemagglutinin family outer membrane protein [Nostoc sp. PCC 7107]
Sequence
MTALGTINTAEKIKPGLMKVTFIGFGALSAICISATYNSSVHAQVTPDNTLNTDVSGSSS
YTITNGNRVGNNLFHSFSQFSLPTGGSVTFNNSTTIENIFARVTGGSVSNIDGTISAQGS
ANLFLLNPAGILFGANAKLSIGGSFVGTSANSIKFADGIEFSATNTTAPLLTMSVPVGLQ
LGSNPGAITVQGTGHNGSFSSTTSISGLNIGTRGLQVQSSKTLALVGGNIALDGGLLSAP
GGQIELGSVSNANVSLNSTSQGFTLSYPSTANFGNIALTQRALASTRDLSRGNGGSVNIQ
GKQVSIRDGSLVLVQNRSNQAAANIVVNATESLDIIGKSSNFSSSSSLVNDTVSSSAAGQ
IIVNTPKLNIDQGGYILNRTFSAAAGGNIVINSDAIDVNGFALGDPFNSRSISQILAASF
GQGNGGNISISTQDLSISAAANITARTYSSGKGGDVNIKADTIQVIGTGAPKGFYFSIIG
ATTFGVGDVGRLNIDTRKLSVQAGARVSASSIDLGNAGSLTINASESVDVSGAKPGESSS
YIGTAVLRFGASRTISRANAGNTTINAPLVTVSDGATIFVQNTGLGTAGNLQINANTLTL
KNGGNLLASTKAGEGGNINLQLRDLLLMRYGGFISAEAAGSGNGGNISINAPVIVGLENS
DIIANAVQGKGGNISITTQGIIGLKFRDTLTPRVDLTNDITASSAFNVNGTVEINNIDVD
PNSGLVELPANVSDPSQKIASGCSNTNGSSFVATGRGGIPQNPTQDLRSDRTWSDIRDIS
AFQKTKSVQAQIPPSPEVLIQATSWHRNPNGKIELIAAQSPTTGQPSLTCAAVPQS
Download sequence
Identical sequences K9QHY9
gi|427710033|ref|YP_007052410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]