SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710106|ref|YP_007052483.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710106|ref|YP_007052483.1|
Domain Number 1 Region: 6-277
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.71e-30
Family Pectate transeliminase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427710106|ref|YP_007052483.1|
Sequence length 695
Comment parallel beta-helix repeat-containing protein [Nostoc sp. PCC 7107]
Sequence
MVNSTLVATLYVNPVTGKDTNDGSRLSPFKTLTRALRTTTPIIIQLAPGNYSAANGEQFP
LVLTAGVTVIGNEVNKGAGIIISGGGEYQSPSFSVQNITLLLLGDASLMGVSVTNPIPKG
TGVWIESSIPYMANNTLLNCGREGIFTTGNAKPAILDNVFVQNAASGLFMARNSKGEVLR
NTFQKNPLGIAITDSAAPLIANNKLSENRTAIALSRDARPVLRQNLIIKNAQGGLLVNAN
AVPDLGSSQDAGSNIFKDNGEFDLQNAAAQPIISAGNQLNLTLVKGQVNFIAATEDTPRI
VTGSSSFPDLVGHWAALFVQALVSRGAISGFPDGTFAPNAPITRAQYAAVLAKTFQLPSN
SKSSQFPDVKPDFWAAAAISSAASAGFISGFPDGTFRPGNNLTRVQAIVSIVNGLKFGGG
TPNVLSVYRDRAQIPSYATNAVAVATQKLIIVNYPQSDLLEPLREITRGEIAALLYQALV
ANSKEKAIASPYIVSPDAEVPTFADLNRHWAEPFIRALASLNLTHGFADGSYQPDKPMTR
AQYAALVAAAFNPAPKRPAIEFIDVPQNFWAYKALQIAASGGFVSGFSDRTFRPDQNVQR
LQVIVSLVNGLGLPAAQSNILLPYTDSNTIPDYAQKAVATATQQRIVVNYPQPSLLAPTR
EATRAEVAAMVYQALVAINRTPNLNSPYIVSTAKS
Download sequence
Identical sequences K9QIZ7
WP_015115522.1.60169 gi|427710106|ref|YP_007052483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]