SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710244|ref|YP_007052621.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427710244|ref|YP_007052621.1|
Domain Number - Region: 28-45
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0706
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427710244|ref|YP_007052621.1|
Sequence length 65
Comment hypothetical protein Nos7107_4953 [Nostoc sp. PCC 7107]
Sequence
MQETFAEFLARTVRRFEVREELSSRNILVNDDQIKEKEKELNISFLDPNYVEIITQEEVW
VKKKE
Download sequence
Identical sequences K9QJY5
WP_015115659.1.60169 gi|427710244|ref|YP_007052621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]