SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427710528|ref|YP_007052905.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427710528|ref|YP_007052905.1|
Domain Number - Region: 69-122
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0294
Family SMI1/KNR4-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427710528|ref|YP_007052905.1|
Sequence length 226
Comment hypothetical protein Nos7107_5257 [Nostoc sp. PCC 7107]
Sequence
MDLILEILPNQQNQSWECSQSLNTPATRFNAYINRLALSAVLPWLEETWNATTTLQSCWE
LVNGTAITIDEIRIVLVPSEAIDLSEIRVPQEWVDIPNWAADYYLAVQVNTEDGLVRIWG
YTTHLQLKQQGEYNQSDYTYSLNNEQITQDINLLWLTRELCPNAPTRSKLKPLPNLTAVQ
ANVLIEQLSKSQFFPKRVLSFESWGALFENQEWRDRLVHSRNLQVS
Download sequence
Identical sequences K9QJD4
gi|427710528|ref|YP_007052905.1| WP_015115940.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]