SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427707270|ref|YP_007049647.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707270|ref|YP_007049647.1|
Domain Number 1 Region: 1031-1072,1099-1316
Classification Level Classification E-value
Superfamily Subtilisin-like 5.37e-74
Family Subtilases 0.0000108
Further Details:      
 
Domain Number 2 Region: 654-757
Classification Level Classification E-value
Superfamily Collagen-binding domain 5.62e-20
Family Collagen-binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 538-641
Classification Level Classification E-value
Superfamily Collagen-binding domain 2.48e-18
Family Collagen-binding domain 0.0032
Further Details:      
 
Domain Number 4 Region: 769-872
Classification Level Classification E-value
Superfamily Collagen-binding domain 5.62e-18
Family Collagen-binding domain 0.0043
Further Details:      
 
Domain Number 5 Region: 884-988
Classification Level Classification E-value
Superfamily Collagen-binding domain 8.37e-16
Family Collagen-binding domain 0.0038
Further Details:      
 
Domain Number 6 Region: 203-309
Classification Level Classification E-value
Superfamily Collagen-binding domain 9.68e-16
Family Collagen-binding domain 0.0047
Further Details:      
 
Domain Number 7 Region: 316-420
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000275
Family Collagen-binding domain 0.0066
Further Details:      
 
Domain Number 8 Region: 427-531
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000301
Family Collagen-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707270|ref|YP_007049647.1|
Sequence length 1318
Comment subtilisin [Nostoc sp. PCC 7107]
Sequence
MDTFHSNTNEHLPFPDSLTNQLDPLQNPLQNLSKQQLGQSQTSASLAIALDFIESKLQEF
AQTPNAYEKLNFVFDIKNASAVATRLADWQNKVFTDRPDILFLSNAELQGAVGAYSAERN
TIYLSETLTQQDPLTGLAKVLLEEYGHALDQQFNSGGDTPGDEGELLSQIVLGQAISDQE
LARLRGEDDRGTLNLDGVDVAVEFDNTIGTAVNVGTLSGNRTYSGSVGSADTNDYYRFTL
GTASNFRLNLSGLSADADVELLNSSGVAIASSLNSGSNSESISSHLTAGNYYVRVYPYSS
TTTSYNLSLTASADAGNSLTLARNIGTLSSTQTFNDFVGTTDTNDYYRFTLGTASNFRLN
LSGLSADADVELLNSSGATIQSSALSGTTSESINSHLAAGNYYVRVYPYGSANTSYNLSL
TASADAGNSLTLARNIGTLSSTQTFNDFVGTTDTNDYYRFTLGTASNFRLNLSGLSDDAD
VVLLNSSGATIQSSALSGTTSESINSHLAAGNYYVRVYPYGSANTSYSLSLTASADAGNS
LTLARNIGTLSSTQTFNDFVGSTDTNDYYRFTLGTASNFSLNLSGLSDDADVVLLNSSGA
TIQSSALAGTASENISRQLTAGNYYVRVYPYSGNTNYTLALSATAIPTIVDNAGNTLATA
RNIGNLSSSRSFQDFVGSIDTNDYYRFALTQSSNFSLALNGLSADADVQLLNSTGGVIVS
SAASGSSAESINRQLTAGTYYVRVYPYSGNTNYNLTLAATAVSQPDGAGNTLATARNVGT
LSSSQSFQDFVGTIDTNDYYRFNLTQTSNFNLLLNGLSSDADVQLLNSTGGLIQGSYGES
SLSESITRTLNAGTYYIRVYPYTSSTNYNLTLSAAAVTLTDGAGNTLAAARNIGTLTGSR
TFQDFVGSSDTNDYYRFNVTQNSNFSLALSGLNADADVQLLNSSGQIIASSVASGLGTEL
ITRTLATGTYYVRVYPFSTGNTNYQLVLTANAAGNFNSTYGYGLVNAAAAVARAIGQTTP
FADVANLGGNNWGNDLVNSPEAWARGYTGQGVVVAVIDSGVDINHSDLRNNIWRNAGEIA
GNGIDDDRNGYIDDVNGWNFGQNQNNNNILPGTTSRGQTHGTHVAGTIAASNNGVGITGV
AHQSRIMAIRMGDVDDQGRFTNAGSLAAAIRYAVDNGANVINMSLGWSDSTELRDALAYA
ASRNVITVSAAGNSSLASPGTPAYYATQYGLSVGAIDINRNIASFSNRAGTNNAIQHIVA
PGVQIYSTIPGDSYGFSSGTSMAAPHVAGVVALMLSANRNLTHAQVRSILTDSSVRLF
Download sequence
Identical sequences K9QCF4
gi|427707270|ref|YP_007049647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]