SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427707517|ref|YP_007049894.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707517|ref|YP_007049894.1|
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-44
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 1598-1781
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-40
Family Histidine kinase 0.00072
Further Details:      
 
Domain Number 3 Region: 1804-1938
Classification Level Classification E-value
Superfamily CheY-like 5.12e-35
Family CheY-related 0.0068
Further Details:      
 
Domain Number 4 Region: 1331-1509
Classification Level Classification E-value
Superfamily GAF domain-like 1.55e-27
Family GAF domain 0.0049
Further Details:      
 
Domain Number 5 Region: 1531-1610
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.49e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 6 Region: 295-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-17
Family G proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707517|ref|YP_007049894.1|
Sequence length 2022
Comment serine/threonine protein kinase and signal transduction histidine kinase [Nostoc sp. PCC 7107]
Sequence
MSIILADYNLIKVLYDDINICIYRAFKESAQISVIIKTLKTVYPTIEQITRIRSEYQTLQ
SLVRLGVIQPLALESIQNGIALILEDFPGEILQDFINTNTLELNNFLQIAIQLALTLSQL
HQNQIIHQDIQPRNILINPNTYEMKIIDFSNASRLYQETQTVNHLNLLEGNLAYISPEQT
GRMNRSIDYRTDLYSLGVTLYQILLGKLPFDVNDPLEIIHSHIAKIPISPQALNSQIPPA
VSNIIMKLLAKTAEKRYQNTLGLKADLELCLNQLKATGKIDNFVVGQLDLSSQLLIPQKL
YGREQEVAQLIDTFEQVSVGATELILVSGYSGIGKSSLVNEVYKPIICQNGYFIAGKFDQ
YKRHIPYAAIIQAIQELIRQLLTESAEKITNWKLKLLSAVGVHGQVIIDVIPDVEKIIGT
QPEIPALGINESQNRFNRLFQKFIYVFSQAEHPLVIFLDDLQWADIASLKLIQLLMSDSE
SKYLLLIGAYRDNEVSPTHPLILALEELQRKDINVNHIILQSLENWQIQQLVSDTLKNRS
EELQELANLIFNKTQGNPFFVTQLLKSLYQDNLLFFNFNTASWQWDIALIKNIAITENVI
ELMINQIQKLSLTTQKILQLAACIGDKFNLDVLSIVNQKSWTVTATELWEALQAGLILPL
DASYKIPLVLNEQLEAKLLTDSLQQPITYKFLHDRVQQASYLLIPDEQKKATHFQIGRLL
LQKTSREEQKEHIFSLVNHLNYGIDFLNPESEKYELAELNLIAGKKAKAAAAYESAVRYC
KIALSLLTTDSWHQQYELTLNLHQEAAEAAFLGGDFEQMELLAEIVLQQAKTQLEKVKVY
ELRIKSCEVQRKLIAAVNLGLEALEMLGVTLNQVPTDLDIQQAIQETKTYLAGKGIEDFI
NSPSMTDADKLAAMRLIASLVPAAYQSAPELFILMACQQVNLSIQYGNTPFSASGFADFS
VVLSGLSQDIEEVYQIGKLALSLLESLDTYEVKSQVLFKVGTFIIHWKHHVRETLPLLED
AYLSGLEAGDLVHTGYSASNKCQYAYWSGAELSNLEQEMAKYSKAIAQIHQETALKWHQV
FHQAVLNLIGLSEKPGLLIGEAYNEEQLLPFHIQSNERTVIHYVFLNKLVLCYLFGDFAK
AVENAIQAEQYLDGVTGWLNVPLFYFYDSLAHLAIYPSAESPHQKLLLDKVQTNQAKMRK
WADHAPMNFQHKYELVEAEKGRVLNQSWQAMADYDKAIAGAKAQGYIQEEALANELAAKF
YFASGREKVAQVYLTDAYYGYSNWGAIAKLRDLEAKYPQIVARLSKRQTLNSDKNQLMHS
INHNISGAFDLATVMKASQALSGEIVLDKLLAKLMYILLENAGAETGYLILTKGDNLFIE
ASGKFGQTEINVRQSNPLESSQNLPISLINYVLRSRENVVLNDATSEGVFTTDNYIVLHQ
PKSILCSPIVNQGKLVGILYLENKLIAGAFTPARLEVLQLLSSQAAISLENARLYHDLAE
YNRTLETKVKERTLELQARNLQLQQEIQERQKAEEVAADANRAKSEFLANMSHELRTPLN
GILGYTQIFKTDNSLSNQQRNGVNIIHQCGEHLLTLINDILDISKIEARRMELELKKFNF
SAFLDGVIEICRLRAEIKGIALVYQPLGYLPELICGDEKRLRQVLINLLNNAVKFTKKGS
ITFKLGYVNQHRDWILDTDKLTAQSPQLKIRFLVEDTGIGIAQEQLEDIFLPFKQVGEDS
RKTEGTGLGLTISRQLVQMMGGELFVESELGKGSIFWLDLELPEVEQLANIDITELNIIG
ISGSKCKILVVDDKWENRSVLVNILEPLGFEVLAASDGLDCLQKMPEFQPDLILMDLVMT
GMDGFEATRRLRLLPNFQEIVVIAVSASVFEFNQQESRKVGCDDFIPKPIQKAELLEKLQ
IHLGLEWVYEDKVRKMKDDQKSSIYPLNLTSQATIVLPPIDELAILLDLAMRGDLGSIAE
KSLKLEERNEKLQPFATCLYQLAKGFKGKQILEFLQKCSETL
Download sequence
Identical sequences K9QCC0
WP_015112960.1.60169 gi|427707517|ref|YP_007049894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]