SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709390|ref|YP_007051767.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709390|ref|YP_007051767.1|
Domain Number 1 Region: 233-398
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-42
Family Histidine kinase 0.0009
Further Details:      
 
Domain Number 2 Region: 15-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.83e-31
Family KaiB-like 0.00097
Further Details:      
 
Domain Number 3 Region: 154-240
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000275
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709390|ref|YP_007051767.1|
Sequence length 401
Comment histidine kinase [Nostoc sp. PCC 7107]
Sequence
MLKHDYMQASQDQPNYFEAPLQLLLFVDGRPQSRQQVQRIRAYLKELQAEYNFEVQIIDV
GQQPYLAEHFKLVATPALIKIHPEPKQVLAGSNIIAQLKNWWPRWQAAVDAYLKLQEDFQ
ERIDDNGRVSPPKSTINSVAVSAELIKLSDEIFHLKQEKERLQEQLQFKDRVIAMLAHDL
RNPLTAAAIAIETLQSNYNIEVGEFQRLKPAMAAHLLKQARTQAKIIDRLIADLLQVGRG
SDKELPIIPQKIELGQLCLEVLEELRDRYTAKSQTLETDIPSDLPCVYADPERIRQVLVN
LLDNAIKYTPSGGKITVAGLHRTTQKIQFSVGDTGPGIPTESRDLIFENHFRLQRDQSTD
GYGIGLCLCQRIVRSHYGQIWVDSSPNGGAWFHFTLPVYPF
Download sequence
Identical sequences K9QIG3
gi|427709390|ref|YP_007051767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]