SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427709681|ref|YP_007052058.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709681|ref|YP_007052058.1|
Domain Number 1 Region: 452-621
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.18e-45
Family Histidine kinase 0.0008
Further Details:      
 
Domain Number 2 Region: 641-762
Classification Level Classification E-value
Superfamily CheY-like 1.15e-30
Family CheY-related 0.012
Further Details:      
 
Domain Number 3 Region: 1-139
Classification Level Classification E-value
Superfamily CheY-like 2.85e-25
Family CheY-related 0.0035
Further Details:      
 
Domain Number 4 Region: 242-355
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-20
Family Flavin-binding PAS domain 0.084
Further Details:      
 
Domain Number 5 Region: 382-463
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.06e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 6 Region: 146-254
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-16
Family Heme-binding PAS domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427709681|ref|YP_007052058.1|
Sequence length 763
Comment multi-sensor hybrid histidine kinase [Nostoc sp. PCC 7107]
Sequence
MLRILLIDDNPHDRLLAINALEREFVDLKIQQIARPQEFEQALSVGEFDLVITDYELRWS
NGIEVLRNIKSRYPEIPIVMFTNNGSQEIAVEAMKSGLDDYVIKSPSNYMRLPVAVRLAL
KQAVTRHQMTGLETRFQTLLNQLNVGVYRITADGIVLDANAAFLQLLGLDSLTEISFNQT
WRSYFSTEDDAQLWQQLRIDAGVRERELLLHRPDGREIWVRISQTFTTNGDTTIIDGIIE
DITERKYAEKALQESEARFRWIFESNVIGICFWNSDGNITAANDAYLQLVGYTRADMKTG
GLHWTDISESEYNEQDLRIIEELKQFGISTPVEKCYIHKAGYRVPILIGCAFREGSQTDG
FTFVVDLTERKQAEQEREQLLQREQTARQTAEAANRVKDEFLAILSHELRSPLNPILGWS
KLLVTHKLSESKISEALATIERNAKLQAQLIEDLLDISQILRGKLSLNIASVNLQSVISA
ALETVQLAAQAKAIEIQTTLSANVGTVLGDPVRLQQVVWNLLSNAVKFTSSGGRVEVRLE
QVGRQAQIQVIDTGQGISSEFLPFVFDYFRQADSQTTRRFGGLGLGLAIVKHLVELHGGA
VWAASPGEGQGAIFNVRIPLIKNQTQLSQSPEQSDIYQELTGIRILVVDDEVDSREVVAF
MLKECGAEVIAVPSAAEALSAFTQLQPDVLVFDIGMPDVDGYMLMRQIRSLPPEKGGQIP
AIALTAYAGELNKQQALFAGFQLHSSKPIEPTELVNLITQLVK
Download sequence
Identical sequences K9QHR5
WP_015115105.1.60169 gi|427709681|ref|YP_007052058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]