SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375294080|ref|YP_005128620.1| from Corynebacterium diphtheriae INCA 402

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375294080|ref|YP_005128620.1|
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-32
Family Thioltransferase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375294080|ref|YP_005128620.1|
Sequence length 154
Comment thioredoxin [Corynebacterium diphtheriae INCA 402]
Sequence
MRPSGNKNGGTVVEKHETSKNFNEGAYMATIDVTEDTFEQTVTKDGIVLVDAWASWCGPC
RAFAPTYEKASENHPDAVFTKLDTEANQGLAAALQIQSIPTLMVFREGIMVYREAGALPP
AALEDLITQVKGLDMEDVKRQIAEQNAQSDSAEL
Download sequence
Identical sequences gi|375294080|ref|YP_005128620.1| gi|376255337|ref|YP_005143796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]