SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000180 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000180
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-41
Family Calponin-homology domain, CH-domain 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000180   Gene: ENSTGUG00000000175   Transcript: ENSTGUT00000000183
Sequence length 201
Comment pep:known chromosome:taeGut3.2.4:24:893430:894890:1 gene:ENSTGUG00000000175 transcript:ENSTGUT00000000183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSAAAMANKGPAYGMSRDVQSKIEKKYDDELEERLVEWIVAQCGAAVGRPERGRLGFQV
WLKNGIVLSRLVNSLYPDGSKPVKIPDAPPTMVFKQMEQIAQFLKAAEDYGVVKTDIFQT
VDLFEAKDMAAVQRTLMALGSLAVTKNDGNYHGDPNWFMKKAQEHKREFTESQLKEGKNI
IGLQMGTNKGASQAGMSYGRP
Download sequence
Identical sequences H0YPI1
ENSTGUP00000000180 ENSTGUP00000000180 59729.ENSTGUP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]