SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000426 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000426
Domain Number 1 Region: 354-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.61e-78
Family Protein kinases, catalytic subunit 0.0000179
Further Details:      
 
Domain Number 2 Region: 39-116
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.91e-32
Family PB1 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000426   Gene: ENSTGUG00000000409   Transcript: ENSTGUT00000000432
Sequence length 614
Comment pep:novel chromosome:taeGut3.2.4:2:4905730:4945620:-1 gene:ENSTGUG00000000409 transcript:ENSTGUT00000000432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEEALNSIMKDLAALGKCGGLLDNNRNKNSVHSNKQRSVRIKFEYEGEKRIIQFPRPVK
FKEVVQKVTDAFGQTMDLVCVNNELLIPLKSQEDLDKAMEQLELSPSLKSLRILVSAPKK
ANVSPSPSALFKQHEMRISRSMGDIMGSLYKDSERTRKYSTGSLHTGRSSPPPGSVPEEQ
QQIARQGSYTSINSEGEFIPETMDQNMLEAFISPDDSLSGSCQSLDRSKATGSLITPEVS
VGMRMHLSKANLSLLLKTRYLFGKGGTFPRQYHLSQSRKDYSDGRRTFPRSYFPQENLFQ
LVPSSRTKSFTGDSKLSTLQYDEYRPKCWNNFTGHQLSSHGRFSPTPSLQAPVNWRLGKL
LGRGAFGEVYLCYDADTGRELSVKQVPFDPDSQETSKEVNALECEIQLLKTLRHDRIVQY
YGCLRDPEEKKLSIFVEYMPGGSIKDQLKAYGALTENVTRKYTRQILQGVFYLHSNMIVH
RDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYGRK
ADVWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPDGVSSSCRNFLKQIFVEE
KRRPTAEDLLRHPF
Download sequence
Identical sequences H0YQ73
ENSTGUP00000000426 ENSTGUP00000000426 59729.ENSTGUP00000000426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]