SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000954 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000954
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-45
Family Calponin-homology domain, CH-domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000954   Gene: ENSTGUG00000000929   Transcript: ENSTGUT00000000966
Sequence length 272
Comment pep:novel chromosome:taeGut3.2.4:28:4361132:4364653:1 gene:ENSTGUG00000000929 transcript:ENSTGUT00000000966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYDPQKEAELRTWIESVTGEQIGRDFQRGLKDGVILCELMNKLQPNAVRKINRSAQNWHQ
LENLSNFIKAMASYGMNPVDLFEANDLFESGNLTQVQVSLLALAGMAKTKGLQSGVDIGV
KYSEKQQRNFDETKMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNQILPPMDHS
TISLQMGTNKCASQVGMTAPGTRRHIYDAKTGTEKCDNSSMSLQMGSNQGANQSGQVFGL
GRQIYDPKYCPQGSQAEVANATGDPPGPGQVP
Download sequence
Identical sequences H0YRP5
59729.ENSTGUP00000000954 ENSTGUP00000000954 ENSTGUP00000000954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]