SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001062 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001062
Domain Number 1 Region: 35-128
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 6.8e-24
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001062   Gene: ENSTGUG00000001039   Transcript: ENSTGUT00000001074
Sequence length 145
Comment pep:novel chromosome:taeGut3.2.4:23:2987758:2989220:1 gene:ENSTGUG00000001039 transcript:ENSTGUT00000001074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGVCKHQIDFDLILENIKDLNSLVGEGIPQIVHTPRGARLGRPEPLPLTLYRNGIVVGHG
AFRPYQHPATQQCLQDIMDGYLPSELQPSYPDGVCLQVTDRRDVVFQKPDLPGSFPGLGQ
AVGTSESNKAQETSTIPGKILNLPQ
Download sequence
Identical sequences H0YS02
59729.ENSTGUP00000001062 ENSTGUP00000001062 ENSTGUP00000001062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]