SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001357 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001357
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.25e-84
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 2245-2472
Classification Level Classification E-value
Superfamily Plakin repeat 2.42e-47
Family Plakin repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 1663-1841
Classification Level Classification E-value
Superfamily Plakin repeat 7.46e-47
Family Plakin repeat 0.00047
Further Details:      
 
Domain Number 4 Region: 1451-1659
Classification Level Classification E-value
Superfamily Plakin repeat 2.09e-45
Family Plakin repeat 0.00012
Further Details:      
 
Domain Number 5 Region: 237-353
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-24
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 4715-4872
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-22
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 2560-2672
Classification Level Classification E-value
Superfamily Plakin repeat 1.96e-20
Family Plakin repeat 0.00086
Further Details:      
 
Domain Number 8 Region: 3828-3969
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-20
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 4930-5090
Classification Level Classification E-value
Superfamily Spectrin repeat 4.83e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 4384-4507
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-17
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 574-709
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1148-1278,1305-1331
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000076
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 4291-4399
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000403
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 14 Region: 3936-4077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000121
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 4626-4727
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000013
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 16 Region: 4190-4260,4295-4329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000851
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 17 Region: 3742-3865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 18 Region: 4513-4632
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000147
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 19 Region: 4040-4150
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000117
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 20 Region: 3316-3467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000012
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 1349-1463
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000128
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 22 Region: 2194-2269
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000217
Family Plakin repeat 0.0027
Further Details:      
 
Domain Number 23 Region: 3431-3531,3609-3633,3667-3691
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000354
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001357
Domain Number - Region: 517-565
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00129
Family Spectrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001357   Gene: ENSTGUG00000001293   Transcript: ENSTGUT00000001370
Sequence length 5139
Comment pep:novel chromosome:taeGut3.2.4:23:3839632:3915107:-1 gene:ENSTGUG00000001293 transcript:ENSTGUT00000001370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGVKLPREKGRMRF
HRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGELGD
MSAKEKLLLWTQKVTAGYIGLKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRE
NLEQAFEIAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISAIEVD
SRWLEYQTRVESLISWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEIPAKEQEKGQ
IEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKLLRPAVERLELLLQIA
NKIQNGALSCEEKLTLAKNTLQADAAHLESGQPVQYESDVVVYLQECEGLLRQLQVDVQI
LRDENYYQLEELVFRIMRLQDELVTLRLECTNLYRKGHFSTLELVPTSTLSTTHLKGESL
TKGLHTSSASWFRKPMTRTELVAISSSEDEGSLRFVYELLAWVEEMQMRLERAEWGTDLP
SVESQLETQRHIHASVEDLGSSVKEARMYEGKMSPNFRASYTETLGKLETQYCKLMETSS
FRLRHLQSLHGFVSRATAELIWLNEKEEEELAYDWSDNNPNIAAKKNYFSELTAELEEKQ
DIFRSLQDTAELLSLENHPAKQTVEAYSAAVHTQWQWIKQLCLCVEQHVKENAAYFQFFS
DARESETYLRNLQDSIKRKYSCDHNTSLTRLEDLLQDSMDEKEQLIQSKSSVASLVGRSK
TIVQLRPRNPEQAVKSTIPIRAVCDYRQIEITICRNNECVLENNSQRTKVISPTGNEAMV
PSVCFLIPPPNKEAIEMASRVEQLYQKVMALWHQLHMNTKSLISWNYLRKDIALVQSFSM
EKLRSLAQGECQQALKSLQAHYEDFLQDSRDSELFSVSDRLRLEEEVESSKEHIRQLLES
MENEDKDETLARSYLSELKNIRLRLEECEQRLVSRIQSPSSARADGDTIQENAIRMAEQE
RTQADLQQLQSELRVVSQRCCSFLDKAPAGPSTPHLRSELDLVVNKMEQTHGLSSIYLEK
LKTVDIIIRSTQGAESLVKGYEVKLSQEEAVPADLAAIQTHRAALQQWLGEVKDKGSVFS
TLEEEMAKAKEVGEQLLRLRQERSIDLERFQEKGSQLWDRWQRACAQIETRHTELESIQE
VLSDYRQCHRALIQWIEEITAQQELMKPGQAEDSRVLSEQLSQQTALAAEIEKNQAKLDQ
CQKFSQQYSAAVKDYELQLMTYRAFVESQQKSPMKRRRMLSSSDAITQEFMDLRTRYTAL
VTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVDKVKELLGWALGLKQSVQGRTAAAGSR
ELGDIEKSISEQQALNEELTAKKEQVSEAIKTSQIFLAKHSHKLSQLEKDQISAQIDALK
ETYQALCSNSTEQLQQLQSQLAQETEHKGSEAVAGVIDLGTVEIFPVFGAMQRGLIDQDT
GLALLEAQVISSDLVVPETSEKLSLEKALARNIIDLRAFQVLQELKDALQQVEEIRCEGR
QLLPVVAAIEEGRISESHGLKILEAELITGGFKFQQGRISMETAVQENLLPTQLHSRLLS
HLEGGKDLIDPNTAEKISLPELLERCIIHQETGLRLLPVKQLAGGMVSLRSGREVSIFRA
VQEGLIDRQVTIRLLEAHLFAGGIVDPRTGHRLTVDEAVRHNLIDQDLACTLLIRQLQTG
GIMDSVTGERLTVDEALRKGLVAPRIALLVLESLGSFVGLLWPETGEIIPVADALEQGIL
STELIQEVLSKRQLLQAVLTPDTTEVMSWQEAVERGVLEREVVKKLKSMAIPDVMASVQL
AGSPSRSRHSHSSPGRSPTGQEEPLLRSDDEKLMFHLMTHSYINIHDGQKVLLVDAELNN
LTKTLIQSQENGSCFEETQADRALESEPCNGVALQQLELQFAPSKGESEKILSPRTALEN
GEVVVGPESLLLEDAEDFLRVEEQEQISTEQEITRSEADAEFGKEHITFTAKDKHQVKLL
MPEPPSDLDSGLIRETEEVMVEAEEESKPPAVDGVEGPEHQKKELESGAVVVKSEISITM
GVPESRDSLKIMAERSQGVREPEREAEDVREVYLPKEGTAENGVLEGEERQSTDMETVLK
VEEGEWEEVLGDEGVEEPSLPAPEEQEAEDTLEKLLMQLQSGGIIHEQTGRALLLDEAVA
SGVVSGHTAVKLMERMKMFSGFFDSQVCESLTTEDVIEEGLMDEKLLQKVLASDKAISGV
LDPGNNFVYSIKDAAAVGLLDKETAMRILEGQVVTGGIVDLKRGKKVSVTLASNLGLIEP
TGRTELVKLEKASKGKGSDEVTRQKLINLQAETSGIADLETKRPLTVAESVEKGLLEKEE
AFQLLTKQVADGGIIHHVSGMRLSVDSAMKHGLINPDLCKELRKAESVVRQDFVHPATKE
KLPLPQAVSLGLLSSEFQRKVQEIQAESGSILDPASGQRLALSQAVQEGLVVEKALASPE
MREGIVDPETCMVVPYSEFLKKCKIDIESGQRYLEVHPFQAIRDEVTGTKLPCAEAVRLG
KVDPLPALRLLQAQADSGGVVEGSVSQRLSLRAAVEQGMLDEPMAKVIATNQLRAGGIVD
ALGGKRLTVKEAVGKGLISQKLAAGLQDVEIPDEEVGSEVCKVGKRQLSQEKVEKLSPKE
EGVTPEHPSVLGTASLPEGAESRGEVDGETEKIERLGLEKEQRRDDQCGPGDSSSSVGIC
HRAAFQETALSQKSLQKSSSFLLWVPEPKPESSIETAAGLARDTAKHKGGKGKKTIPGKD
TETPREDQGFPVPPEHGETQEERSGIRLRAGSILIQCRQRRGGGGQCQPEAVPEGSWLIS
QKLAAGLRDLEIPDEEVGSEVCKVGKRQLSQEKVEKLSPKEEGVIFPARSARSDGAEPKA
QPEPWWKKGSQKAAPNCSWAQRLTSVVQETPAALRESVTVGPGKGGMGPAESGEPPEVDV
PVGDELGGKKAVKHTERETSPTEGPIDQEKTSETELKPTQKKKSKKKKAKQGSIPGDSTQ
PEKPAEKQLLPSLGGKGKKTIPGKDTETPREDQGFPVPPEHGETQEVVKGGIKDGHDSLV
ALSLEERMAQDDTRVETTWDVSSTATMAQELPSDLIITEEPTEVQETSAKQHEQRAELRA
DQAPAPPKSQEEPPQERSKQPGPGDRGLLLPVIVEGELLETSRESTRPAQIKFSKKMCLE
HDQRLISYLSMLRDIEMRIKRVQPAEQNLAALHDLRQQAEALGAELQELSFSVNQELDAV
QRIVANPPEEVPEQLLKALEKDAKNLQKSLGSASEVLQSRLQNLRGAAEAEKAKILAHHE
ALQGRLQELLSWVSGTAASLGDGDLQPATDASSLSHCLQHYEELKEPLAATKAELDATAF
DIQFLISEHAQDLTPQQSRQLLRLLNELQKAFRDLSERVTARLEVLQVCLQQVEQTEQVK
TLQEQQAARARSLAELSRWLGQAEDTLAEQQRAEGDLPALQQRQSDVKVTQGFQVIITAS
LTLPKGGPLMGEDCQSHPSPFGVGALEARLRFSTASLYLPESHKGSLLNMQELGHSYLEP
LCFQVKAAKELEENSNKIDSLLDWVASLEEKGALPEYRPHPVHQGTGTPAGKSTGDVPDG
HAVGADSAAESLDEHYERLKAQHQELLSQQQDVILAWQAAQAFLDKQGPGEERERLRARL
AELRERYPASLARAEAPLKAQLLREELHKFLRDHGEFEACLEQAEQDLQGMCKGDSDPAS
LRQLLRRQGSFSEDVISHGDLRFVNMSGRKFLDGDAGDAESHLLMSRRVVKSKLEDATQR
YTTLHSKCSKLGSHLNTLLDHYQQFQEVAESLRMWLQESEAALGKLLSETVSSDLAVLQK
QLASTKQLQGDLAEHQVPVEKLQKAARTLLDIQGEPAPDHGHIQETTDAIVSRFQSLSQQ
MSERSDLLQKSIAQSQSVQESLESLLQSVAEVEKNLEKDQPAVLSSASIQDSLATSVKLK
QDIARQRSCLEATREMVTRFTEAADSPAASALQDKLAQVTEHFGRLCQQQQEREDTLKGL
LPTVEQYEQLWERLQQFTESRTRMLASGNQPDRGIAHFSQHIQELNSELRQHQEDLATLE
HLAEELSSCGFAPGAFQQQEKLQSLKKDFLQLQKVAKDREKDASSCQEQLDEFRDLVGAV
RKWLRESEGKIPPAETSLGTQELQQHRQQIQDLLEEWKGKGPQVEEIGRRGTLLENLIVE
ITAPSTPPKAGATLPTPGGSGGSVNGYHTCKDLTEIQCDVSEVRRRYQALGAALRERQQQ
LSAMLDRMQEVQEEASSMLKWLESKERMLSELEASSSPTKTETMRAQAEHNKAFLAELEQ
NSGKIQKVKEALSGLLEKYPDSPEAANWKKMQEDLNCRWERASQATAARQQKLEESASQL
ATFQATEAQLRPWLMEKELMMSVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNQ
AAQSILTGPGDVSPSTSQVRDELQGVNQKWSELTERLNSRSSQIDQAIVKSTQYQELLQG
LSEKVKAVGQRLSSQSAISTQPDAVKQQLEETSEIRSDLEQLEEEISEAQNLCDDLSVLI
GEQYLKDELRKRLETVALPLKGLEDLAADRMNRLQTALASSQQFQHMFDELRTWLDDKRC
QQAQSQPISAKLERLQSQIQEQEEFQKSLNQHSGSYEMIVAEGESLLLSVQPGEEKTTLQ
NQLVSLKTHWEELSKQAADRHSKLKDCLQKAQKYQRHADDLLPWVEDCKARMAELEVTLD
PVQLEATLLRSKAMLSDVEKRRSLLEMLNSAADILTDASQTDEDDIRDEKASINQKMDAI
TEELQTKTGSIEEMSQRLKEFQESFKNIEKKLEGAKHQLEIYDALGPQACSNKNLEKLRA
QQEVLQTLEPQVEYLKNLTQGLVEDAPAGSDCSQLLSQAEVAQQDFKAVKQKVNDCCALM
ENKLEGIGQFNSRVREMFSQLADLDDELDSMGPIGRDSDSLQSQAEDVRAFLGKLQRLKS
DIESSESECRKMLEDEGSPDLLGLKRELETLNKQCSKLTERGRSRQEQVETTLSRVEDFY
SRLKELSRMTAAAEEHEALQWVVGTEVETINQQLADFKV
Download sequence
Identical sequences H0YSU6
ENSTGUP00000001357 ENSTGUP00000001357 59729.ENSTGUP00000001357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]