SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Taeniopygia guttata 69_3.2.4 > ENSTGUP00000001597

Domain assignment for ENSTGUP00000001597 from Taeniopygia guttata 69_3.2.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSTGUP00000001597
Domain Number 1 Region: 462-534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 2 Region: 269-341
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 3 Region: 898-970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.09e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 4 Region: 209-279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 5 Region: 81-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 6 Region: 330-392
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0004
Further Details:      
 
Domain Number 7 Region: 772-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000367
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 8 Region: 585-646
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000813
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 9 Region: 649-714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000114
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 10 Region: 524-586
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 11 Region: 1029-1086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 12 Region: 959-1026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 13 Region: 21-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000223
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 147-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 834-908
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000944
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 16 Region: 727-777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 17 Region: 417-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000655
Family Complement control module/SCR domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001597
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0688
Family Complement control module/SCR domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001597   Gene: ENSTGUG00000001539   Transcript: ENSTGUT00000001611
Sequence length 1086
Comment pep:novel chromosome:taeGut3.2.4:26:3770885:3813444:-1 gene:ENSTGUG00000001539 transcript:ENSTGUT00000001611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
SSTCLENLTWSQPAELCRRRSCGTPGALPGGRMGPLTDLQLGARVEVFCEPEYKLVGNNF
IWCQLEGNDVEWSKLPTCELITCSPPPPISHGRHDGEGIEIFPYNSTVTYSCDPKFQLVG
NGSIQCGSRDKTSGVWSGATPECKGAALCPFPRVWHGTVSPRRYYYRTGDTVSVTCSPGY
TLQGSRSSTCGAASRWDPPLPQCRKVRPCPMPPEVANGKHNGQDKAFFTAGMAVRYSCDP
GYYLVGNAAVSCRASGNWSQPGPRCAGKQCGHPGEPVNGKIISLTNLQFGSTVVYRCEEG
HRLIGQASRRCEISGGGVAWTGHVPLCQRIPCEPPPDIPHGQHSGRLLSEFHYGTAVTYS
CQPGFPLHGHPSIHCTTRDGYSGVWSEPLPACGGFSGCRAPARLGFAELKEPYRNRTVFP
EGSRVELVCQPGYTQLPGASAAITCLRNQTWSAALDFCKRKQCPSPGNPANGRAVVLTDL
LFGSKINYTCDKGYKLVGGSQRICEVSGTHVSWSGDPPVCQRLTCAPPPAIPHGTHSGGS
RDSFSLGDVVTYTCASGLALAGGASLSCTSVDGQHGTWSGAVPRCQAIGCTRPEMENGKV
TGSETTYNLEDIVIFECNFGYALKGSQESQCQFGGKWHPPVPTCEKLPSCPSPPTIRNGH
HDSKDVTEFIPGMAVKYHCDPGYVLTGKTTVSCLPSGNWSIPYPWCEVITCSIPRIKKLK
VDEGRRAVYHPGDNVTFQCHPGFVLRGSRGAKCQPDSHWVPAVPTCQPVLQCPSPPNIEK
GKHDSQDLEVFPTGMVVNYSCDPGYSLRGEASIYCTSSGNWSLPVPQCAAWSGCGAPPNL
TFAELTREYKNQLEFAVGDTVHYSCRPGHSRRHGVPPTLTCLQNHTWSEALEFCKRKQCR
HPEPPRNGRVVVLTDLLFGSTVSHTCDEGYRLVGQPHRRCEILGRGVAWTGLPPICQKIP
CEPPPKIANGDYEERSSYVYQSSVTYRCRDVPRGSDPFSLIGPDTIHCTADAHSNGVWSG
PPPQCRGLVKCEDPRVENGRKTSGFGLPYRYKDSVVFECNQGYVMVGEMVITCEENNTWV
PPKPTC
Download sequence
Identical sequences H0YTI4
ENSTGUP00000001597 59729.ENSTGUP00000001597 ENSTGUP00000001597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.