SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001598 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001598
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000134
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 19-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000123
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001598   Gene: ENSTGUG00000001552   Transcript: ENSTGUT00000001612
Sequence length 177
Comment pep:novel chromosome:taeGut3.2.4:26:3802426:3871462:-1 gene:ENSTGUG00000001552 transcript:ENSTGUT00000001612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIPLLLSLLQKKESESGDCGPLPNISHAEPRGDTKHQQSFSVGSTVTFSCLPGYTKLPLL
PDTIRCLSNSRWSSLPEFCGRSCPRPRSVSFAAISPEDKMQNFYAVNTTVRYICRQGYEN
TTAQPPTSTCLDNLTWTEVPKLCQKKSCGVPASPEHGQVILKDHQLGATASVVCDRG
Download sequence
Identical sequences H0YTI5
ENSTGUP00000001598 59729.ENSTGUP00000001598 ENSTGUP00000001598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]