SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001784 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001784
Domain Number 1 Region: 390-611
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-31
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 86-236,379-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.42e-24
Family HI0933 N-terminal domain-like 0.085
Further Details:      
 
Domain Number 3 Region: 679-709
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000298
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001784   Gene: ENSTGUG00000001721   Transcript: ENSTGUT00000001801
Sequence length 718
Comment pep:novel chromosome:taeGut3.2.4:26:4123182:4128575:-1 gene:ENSTGUG00000001721 transcript:ENSTGUT00000001801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPADEPGNPAHAIFERFLRAGECREVLGCFVELCQQLGLQGSGLQLYHGLKAALNYWN
AKALWSKLDKKAGHKDYEQGTACAGTKCLVVGAGPCGLRAAIELALLGARVVLLEKRDSF
SRNNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLILLKVALLLGVEVHINV
RFEGLVPPTGKAGGWQAVLQPSSSPLTHYEFDVLISAGGGKFVPEGFKRKETRGKLAIGI
TTNFINRHSRAEVEVAEISGVARIYNQKFFQNLYNRTGIDLENIVYYKDDTHYFVMTAKK
QSLLKKGVILQDKADIESLLAPENVNRDALLSYAKEAANFSTNYCLPQLEFALNHRGLPD
VDMFDFTCMTRSENAALVREHNGSRVLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
RRWAAGTPPLEVLAERESIYQRLSQTSPDNTNKNISQYSIDPATRYPNINLQAIKASQVR
DLYLVGTVEVDHKRKSDNRLSTVAPGAVSEELLSWCQASTAGYPGVAVTNFSTSWTSGLA
LCALIHRFRPDLVDFDSVEPQDALRTHQMLLDIAEQELGIQPVLSSAEMATMTEPDCLGL
ITYLSHFYQIFGTSPGVSKKPLSPRGTRGAILFLSKLQKSRTLAHKRTQVRTPPTASRST
KTLPACPLPPQPPRERAGDNSDACYFCGRRVYIVERASAEGRFFHRGCFQCRRCAATL
Download sequence
Identical sequences H0YU16
59729.ENSTGUP00000001784 ENSTGUP00000001784 ENSTGUP00000001784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]