SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002017 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002017
Domain Number 1 Region: 360-621
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-81
Family Protein kinases, catalytic subunit 0.0000098
Further Details:      
 
Domain Number 2 Region: 42-120
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.22e-35
Family PB1 domain 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002017   Gene: ENSTGUG00000001958   Transcript: ENSTGUT00000002035
Sequence length 625
Comment pep:novel chromosome:taeGut3.2.4:27:445393:470340:-1 gene:ENSTGUG00000001958 transcript:ENSTGUT00000002035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQEALKSIMKDLVALQMGRRHRLPGYDTMKNKDTAHSNRQNDVRIKFEHNGERRIIPFV
RPVRYEDVQQKVKTAFGQPLDLHYMNNELSIPLKNQDDLDKAVDLLDRSSNVKSLRILLL
SQDRNHTSSSPHSGLPKQVRIKTSQSVGDVSTPYQQPEPRSRHLSVSSQSTGRSSPPPGY
VPERQQRIARQGSYTSIHSEGEFIPETSEQCMLDPLSSAENSVSGSCQSLDRPANCPSFR
KSRMSRAQSFPDNRQEFSDRENQIYDKAGKGGTYPRRYNVSMQHKDYNDGRRTFPRIRRH
QGNLFTLVPSSRSLSTNGENLGLALQYLDPRGRLRSADSENALGVQERNIATKSPSAPIN
WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPESPETSKEVSALECEIQLLKNLQH
DRIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGVSYLH
SNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISG
EGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHCRDFLK
QIFVEARHRPSAEELLRHQFAQLQY
Download sequence
Identical sequences H0YUP8
ENSTGUP00000002017 ENSTGUP00000002017 59729.ENSTGUP00000002017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]