SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002069 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002069
Domain Number 1 Region: 120-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000124
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002069   Gene: ENSTGUG00000002009   Transcript: ENSTGUT00000002088
Sequence length 185
Comment pep:novel chromosome:taeGut3.2.4:1A:2787655:2797045:-1 gene:ENSTGUG00000002009 transcript:ENSTGUT00000002088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKWLLMWLLFGFIKAKKPGVCPSLPPTEFADVTAEMYPAQTRLYYTCDPGYGRKASEY
LGIQCKIEQQGAVWKHQLFKCFEQKDLSSMDPMMELELAQKPEREPRSAAPQKQEDLSDS
FCGPPKTVPHASIKLPQEHYVGQVLHFKCQSGYDKRPPTFGSRTCKEVNGKTFWTPLDMR
CTNDS
Download sequence
Identical sequences H0YUU9
59729.ENSTGUP00000002069 ENSTGUP00000002069 ENSTGUP00000002069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]