SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002168 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002168
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.97e-18
Family Steroid-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002168   Gene: ENSTGUG00000002102   Transcript: ENSTGUT00000002188
Sequence length 106
Comment pep:known chromosome:taeGut3.2.4:4:7353769:7365484:-1 gene:ENSTGUG00000002102 transcript:ENSTGUT00000002188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIILVFSGNVFAVTKGSKFYGSEGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNA
VQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHTKQE
Download sequence
Identical sequences H0YV47
ENSTGUP00000002168 59729.ENSTGUP00000002168 ENSTGUP00000002168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]