SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002635 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002635
Domain Number 1 Region: 275-328
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 2 Region: 184-265
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000131
Family PB1 domain 0.0041
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily SH3-domain 0.00000512
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002635   Gene: ENSTGUG00000002563   Transcript: ENSTGUT00000002663
Sequence length 333
Comment pep:novel chromosome:taeGut3.2.4:17:721680:728182:-1 gene:ENSTGUG00000002563 transcript:ENSTGUT00000002663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDAQSGYHRVLAPYRPAEPGPEVAAGSLVFVLGRAADGWATAIHDGQKLHIPSSLLEPAS
RMDKWKISTGIPLPPAQVPPSRLSLKQKPGNPWAVAEAVPNPAGGLRRWPTAASADCRAV
PLPLCCSAAPPGEENASINDASAHMESKVRSSGDQGWEDPLCKRQLSLNTLLSLPSSSCA
SAGTDRPSVLRLRCECSLVLRAGEAPALPALRALMRDRLAQQAQRGTLSYRLLDGTELGT
VLGQEDLGKVWQQLTDGRLTLCCQDSDSHSGRPVLYQMLAQHSYLAQGPGDLEFSKGDVL
DILSEVNEDWLEGCCNGKTGIFPKCFATQTSCD
Download sequence
Identical sequences H0YWG2
ENSTGUP00000002635 59729.ENSTGUP00000002635 ENSTGUP00000002635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]