SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002803 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002803
Domain Number 1 Region: 83-328
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.24e-105
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.0000000164
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.32e-25
Family CAD domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002803   Gene: ENSTGUG00000002721   Transcript: ENSTGUT00000002832
Sequence length 333
Comment pep:novel chromosome:taeGut3.2.4:21:2536494:2539417:-1 gene:ENSTGUG00000002721 transcript:ENSTGUT00000002832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLRPFRLRGCGGPQKFGVAAGSLRALLRKGCRLLQLPLAGSRLCLYEDGTELTESYF
RALPPQTELVLLGPGESWRGCASDIERLLAAFCSQQGAVVEAARRMLTDERAPRRQKLLA
DLIHNLSENILAEDKEDDKKWFEGLESRFKNKSSYLRHSCESRMRGYMREVSGFISNVHP
AARDAYRGIIDLMADKLKSVKYNGCYFDRREEEEAARLCTAEGWFSCQGPFDRDDCPCKH
SINPYSNRESRILFSTWNLDHVIEKKRAVVPELAEAVKTRDEREVNWEYFYQLLFTLDNL
KLVHIACHKKTNHNLSCDKTRIYRKRKQTHEIS
Download sequence
Identical sequences H0YWX9
ENSTGUP00000002803 XP_002196446.1.42559 ENSTGUP00000002803 59729.ENSTGUP00000002803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]