SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003148 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003148
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 7.07e-24
Family Steroid-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003148   Gene: ENSTGUG00000003054   Transcript: ENSTGUT00000003178
Sequence length 130
Comment pep:known chromosome:taeGut3.2.4:3:13070235:13073173:-1 gene:ENSTGUG00000003054 transcript:ENSTGUT00000003178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVRLFTEPELARYDGQQEGQPIYLAVKGVVFDVTSGKEFYGKGAPYNALVGKDSTRGVAK
MSLDPADLTHDTTGLTEEELKSLDDIFNNVYKAKYPIVGYTSRRILNEDGSPNLDFKPED
QPHFSIKDEF
Download sequence
Identical sequences H0YXX2
ENSTGUP00000003148 ENSTGUP00000003148 59729.ENSTGUP00000003148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]