SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003347 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003347
Domain Number 1 Region: 20-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.0000061
Further Details:      
 
Domain Number 2 Region: 131-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000678
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003347   Gene: ENSTGUG00000003252   Transcript: ENSTGUT00000003381
Sequence length 179
Comment pep:novel chromosome:taeGut3.2.4:21:4433659:4435762:1 gene:ENSTGUG00000003252 transcript:ENSTGUT00000003381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLFILLAVLNSGVRSSIVQQKMYGRITSPNFPKVYPNHKEKIWNITVPKGYSVRIYFTHF
NLELSYLCEYDYVKLSSGGKTLAMLCGRDSTDTEEAPGNRTYISADNHLTVVFRSDYSNE
KPFTGFEAFYAAEDIDECKQPLDTKPLCSHHCHNYVGGYYCSCRVGYILHENKRTCTGE
Download sequence
Identical sequences H0YYG9
59729.ENSTGUP00000003347 ENSTGUP00000003347 ENSTGUP00000003347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]