SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003629 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003629
Domain Number 1 Region: 31-207,242-405
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.57e-76
Family YicI catalytic domain-like 0.0000846
Further Details:      
 
Domain Number 2 Region: 408-488
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.53e-17
Family Putative glucosidase YicI, domain 3 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003629
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00314
Family YicI N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003629   Gene: ENSTGUG00000003478   Transcript: ENSTGUT00000003668
Sequence length 555
Comment pep:novel chromosome:taeGut3.2.4:1A:14568225:14614761:1 gene:ENSTGUG00000003478 transcript:ENSTGUT00000003668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDVTLSPNPSLTFRTIGGILDFYLFMGPTPENVVQQYTEAIGRPHMPAYWSLGFQLSRYG
YNSLDALKATVDRMKHYDIPYDVQHYDIDYMERHLDFTYDKVNFAGLPEFMKELKKNGKH
NVVILDPFVTKDEEPGTYRPYELGQEMGVWVNNSDGVTPAVGQAWPPGYSVFPDFTNPRT
VEWWTTLCLEFKDVLDYDGIWIDMNEPSNFMRGQIPGCADTEINNPPYTPSITDRSLAEK
TLCPDSKTYLGDHYNTHSLFGWSQTEPTFNVVQQATGKRAFVLSRSTFVGSGKHGAHWLG
DNFSLWKDLRRSIIGILEFNLFGIPYIGADICGFNYNTTYELCLRWMQLGSFYPFSRNHN
SEGNIEQDPAVFGDTFAEISRDTLRIRYSLLPYLYTLFYESHVHGGTVARSLMHEFTSDQ
ETHGIDTAFLWGPAFMIAPVLEEATRSVSVYFPEAQWFDYYTVLPSAWKKTYTTVSAPLN
KIPLYIRGGYILPQQAPATTTTESRLNPFGLIIALDEEGQASGSLFWDDGDSIDTIEKEN
YFLAKYTFSNVSGNI
Download sequence
Identical sequences H0YZ95
ENSTGUP00000003629 ENSTGUP00000003629 59729.ENSTGUP00000003629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]