SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003936 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003936
Domain Number 1 Region: 113-563
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.86e-104
Family Amylase, catalytic domain 0.000000501
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003936
Domain Number - Region: 570-627
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0144
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003936   Gene: ENSTGUG00000003806   Transcript: ENSTGUT00000003978
Sequence length 687
Comment pep:novel chromosome:taeGut3.2.4:3:16774192:16786455:1 gene:ENSTGUG00000003806 transcript:ENSTGUT00000003978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEARSLPMELSEKGGVQNNGFVQNEDFEDKETDTNSQEEMPKTCSVDVEPVAVEETVLK
PYAGMPKEVLLQFSSQARYRVTREILFWLVIAGSVVLVCATIAIIALSPKCLDWWQASPI
YQIYPRSFRDSNMDGNGDLKGIQEKLDHITYLNIKTIWITSFFKSPLKDLGYGAEDFYDI
DPIFGSMTDFENLIAAIHDRGLKLIMDLIPNHTSDKHRWFQLSRNRTGQYTDYYIWQDCR
QAAGSVIPPNNWVSVFGNSSWQFDDVRKQCYFHQFGKEQPDLNFRNPAVQQEIRDIIKFW
LGKGVDGFSFGAVKFFLEATHLRDEPPVNKSQNGETITAYSQLYHDYTTTQVGLHDIIRS
FRHTMNEFSREPGRYRFMGSDDDEKEDIKATMMYYGTTFIQEADFPFNFNLINMKALSGN
SIFEAVNSWMKNMPAGKWPNWAVGSPNAARISTRVGKEYINVMNMLLLTLPGTPVTYYGE
EIGMENIASENVSEEHVNSGPVPTLPEKSPMQWDGEVNAGFTEGNSSWLPVNSDYQSVNV
EIQSTWSNSTLSLYRALTLLRNNELPMNRGWMCHVWNDTDVFVYVRELDGLDRVFMMVLN
FGQETTTDLQAVAPNLPSEAVIRLSTHVSNAGKVVNTKLIKTEMGEGLVLEYRTTKPVHT
MEAFQGKCFVAEKACYSKALNLLYMNC
Download sequence
Identical sequences H0Z051
59729.ENSTGUP00000003936 ENSTGUP00000003936 ENSTGUP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]