SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004030 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004030
Domain Number 1 Region: 351-429
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.14e-23
Family PB1 domain 0.00016
Further Details:      
 
Domain Number 2 Region: 453-509
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 3 Region: 8-151
Classification Level Classification E-value
Superfamily TPR-like 3.48e-19
Family Tetratricopeptide repeat (TPR) 0.00000752
Further Details:      
 
Domain Number 4 Region: 232-301
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-16
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004030   Gene: ENSTGUG00000003893   Transcript: ENSTGUT00000004074
Sequence length 510
Comment pep:novel chromosome:taeGut3.2.4:8:3055306:3065696:1 gene:ENSTGUG00000003893 transcript:ENSTGUT00000004074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVETIRLWQEGVCAADRKEWSAALEAFAAVQNPPAKICFNMGCIQLVLGKLAEAEQAF
TRSIGCDKHLAVAYFQRGTVFYRRQNHGKAIEDFKEALAQLRGNQLIDYKILGLRYRLFA
CEILYNIALVYATTGNWEKAEEHLTLAMSMKSEPQHNKIDRAMEAILKQKLCELVAIPVG
KLFRPNEKQVAQLEKKDYLGKAMVVASVVDKDDFSGFAPLQPQASGPPPRPKTPEILRAL
RGQPHRVMYEFIPETAEELQVLPGNIVFVLKKEKDNWATVMFNGKKGIVPCNFLEPVELQ
NKLQQTRGEETPVEAEIPESPTSPVPEKPRRLAPGHQSPQSHNLEAEPTLSRPHVLKVHY
KFTVALRVDRGLSYRELLELVCKKLELQPEHTELRYKPVEGQELLPLRAENVEVAWSQSK
DNCLTVWCNGTEGEGFVPDSKPGESPQEATPGEMGPNHVVAQYSYEATQPEDLEFQAGDT
ILVLSKVNEDWFEGECRGRTGIFPSAFVQQ
Download sequence
Identical sequences H0Z0E3
ENSTGUP00000004030 59729.ENSTGUP00000004030 ENSTGUP00000004030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]