SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004133 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004133
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.17e-22
Family Steroid-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004133   Gene: ENSTGUG00000004018   Transcript: ENSTGUT00000004178
Sequence length 226
Comment pep:novel chromosome:taeGut3.2.4:19:4090595:4094125:-1 gene:ENSTGUG00000004018 transcript:ENSTGUT00000004178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRARLLSAAELRRYRGAPGEPGLYLDLLGRVFDVQRGRKHYGPGGAYSGFAGRDATRAFA
SGDFTPAGLVDTVSGLSPVELLSIHSWLSFYSDNYEPVGKLVGRFYDENGAPTEALREVE
AAIEEALKLQEQSDEKKQQFPPCNSEWSSAKGTRFWCSRESGGVRRGWAGVPRQLHRPGS
QGARCVCVRSSGPPWGQPRSSRHSDRGDLDNPLRQYEGCHPLAEQC
Download sequence
Identical sequences H0Z0P6
ENSTGUP00000004133 ENSTGUP00000004133 59729.ENSTGUP00000004133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]